Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   AB0R80_RS12865 Genome accession   NZ_CP160213
Coordinates   2638453..2638890 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain JM199     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2633453..2643890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R80_RS12815 (AB0R80_12815) sinI 2633837..2634010 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R80_RS12820 (AB0R80_12820) sinR 2634044..2634379 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R80_RS12825 (AB0R80_12825) tasA 2634427..2635212 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R80_RS12830 (AB0R80_12830) sipW 2635277..2635861 (-) 585 WP_015240205.1 signal peptidase I SipW -
  AB0R80_RS12835 (AB0R80_12835) tapA 2635833..2636504 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R80_RS12840 (AB0R80_12840) - 2636763..2637092 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  AB0R80_RS12845 (AB0R80_12845) - 2637132..2637311 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R80_RS12850 (AB0R80_12850) comGG 2637368..2637745 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R80_RS12855 (AB0R80_12855) - 2637746..2638141 (-) 396 WP_327935032.1 ComGF family competence protein -
  AB0R80_RS12860 (AB0R80_12860) comGE 2638155..2638469 (-) 315 WP_060674611.1 competence type IV pilus minor pilin ComGE -
  AB0R80_RS12865 (AB0R80_12865) comGD 2638453..2638890 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R80_RS12870 (AB0R80_12870) comGC 2638880..2639188 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R80_RS12875 (AB0R80_12875) comGB 2639193..2640230 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R80_RS12880 (AB0R80_12880) comGA 2640217..2641287 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R80_RS12885 (AB0R80_12885) - 2641480..2642430 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  AB0R80_RS12890 (AB0R80_12890) - 2642576..2643877 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=1019169 AB0R80_RS12865 WP_012117983.1 2638453..2638890(-) (comGD) [Bacillus velezensis strain JM199]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1019169 AB0R80_RS12865 WP_012117983.1 2638453..2638890(-) (comGD) [Bacillus velezensis strain JM199]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAGATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment