Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R80_RS12815 | Genome accession | NZ_CP160213 |
| Coordinates | 2633837..2634010 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JM199 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2628837..2639010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R80_RS12800 (AB0R80_12800) | gcvT | 2629650..2630750 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R80_RS12805 (AB0R80_12805) | - | 2631174..2632844 (+) | 1671 | WP_015417810.1 | SNF2-related protein | - |
| AB0R80_RS12810 (AB0R80_12810) | - | 2632866..2633660 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R80_RS12815 (AB0R80_12815) | sinI | 2633837..2634010 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R80_RS12820 (AB0R80_12820) | sinR | 2634044..2634379 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R80_RS12825 (AB0R80_12825) | tasA | 2634427..2635212 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R80_RS12830 (AB0R80_12830) | sipW | 2635277..2635861 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB0R80_RS12835 (AB0R80_12835) | tapA | 2635833..2636504 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R80_RS12840 (AB0R80_12840) | - | 2636763..2637092 (+) | 330 | WP_060674607.1 | DUF3889 domain-containing protein | - |
| AB0R80_RS12845 (AB0R80_12845) | - | 2637132..2637311 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R80_RS12850 (AB0R80_12850) | comGG | 2637368..2637745 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R80_RS12855 (AB0R80_12855) | - | 2637746..2638141 (-) | 396 | WP_327935032.1 | ComGF family competence protein | - |
| AB0R80_RS12860 (AB0R80_12860) | comGE | 2638155..2638469 (-) | 315 | WP_060674611.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R80_RS12865 (AB0R80_12865) | comGD | 2638453..2638890 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019166 AB0R80_RS12815 WP_003153105.1 2633837..2634010(+) (sinI) [Bacillus velezensis strain JM199]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019166 AB0R80_RS12815 WP_003153105.1 2633837..2634010(+) (sinI) [Bacillus velezensis strain JM199]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |