Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABVR74_RS00795 Genome accession   NZ_CP159484
Coordinates   165942..166226 (+) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain CBA3648     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 160942..171226
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABVR74_RS00765 (ABVR74_00765) comGA 162534..163472 (+) 939 WP_353891726.1 competence type IV pilus ATPase ComGA Machinery gene
  ABVR74_RS00770 (ABVR74_00770) comGB 163420..164439 (+) 1020 WP_058223571.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABVR74_RS00775 (ABVR74_00775) comGC 164566..164835 (+) 270 WP_023188581.1 competence type IV pilus major pilin ComGC Machinery gene
  ABVR74_RS00780 (ABVR74_00780) comGD 164810..165226 (+) 417 WP_025017137.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABVR74_RS00785 (ABVR74_00785) comGE 165198..165494 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABVR74_RS00790 (ABVR74_00790) comGF 165457..165903 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABVR74_RS00795 (ABVR74_00795) comGG 165942..166226 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABVR74_RS00800 (ABVR74_00800) - 166308..166745 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  ABVR74_RS00805 (ABVR74_00805) - 166742..167584 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  ABVR74_RS00810 (ABVR74_00810) - 167761..168498 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ABVR74_RS00815 (ABVR74_00815) - 168491..169300 (+) 810 WP_014570791.1 metal ABC transporter permease -
  ABVR74_RS00820 (ABVR74_00820) - 169338..170204 (-) 867 WP_025017140.1 RluA family pseudouridine synthase -
  ABVR74_RS00825 (ABVR74_00825) - 170409..170786 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=1013806 ABVR74_RS00795 WP_025017139.1 165942..166226(+) (comGG) [Lactococcus lactis subsp. lactis strain CBA3648]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=1013806 ABVR74_RS00795 WP_025017139.1 165942..166226(+) (comGG) [Lactococcus lactis subsp. lactis strain CBA3648]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585


Multiple sequence alignment