Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ABU981_RS15875 Genome accession   NZ_CP159146
Coordinates   3492897..3493427 (+) Length   176 a.a.
NCBI ID   WP_161668558.1    Uniprot ID   -
Organism   Proteus mirabilis strain 10035004-2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3454355..3501675 3492897..3493427 within 0


Gene organization within MGE regions


Location: 3454355..3501675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABU981_RS15580 (ABU981_15580) - 3454355..3454546 (+) 192 WP_143475534.1 DNA polymerase III subunit theta -
  ABU981_RS15585 (ABU981_15585) - 3454576..3456945 (-) 2370 WP_143475536.1 SGNH/GDSL hydrolase family protein -
  ABU981_RS15590 (ABU981_15590) - 3457003..3459471 (-) 2469 WP_143475537.1 host specificity factor TipJ family phage tail protein -
  ABU981_RS15595 (ABU981_15595) - 3459458..3459850 (-) 393 WP_143475630.1 NlpC/P60 family protein -
  ABU981_RS15600 (ABU981_15600) - 3459847..3460317 (-) 471 WP_143475539.1 DUF1833 family protein -
  ABU981_RS15605 (ABU981_15605) - 3460317..3460793 (-) 477 WP_109409994.1 hypothetical protein -
  ABU981_RS15610 (ABU981_15610) - 3460797..3464198 (-) 3402 WP_353629035.1 tape measure protein -
  ABU981_RS15615 (ABU981_15615) bamE 3464262..3464642 (-) 381 WP_063073753.1 outer membrane protein assembly factor BamE -
  ABU981_RS15620 (ABU981_15620) - 3464712..3465404 (-) 693 WP_143475542.1 DUF6246 family protein -
  ABU981_RS15625 (ABU981_15625) - 3465454..3466209 (-) 756 WP_353629034.1 Ig-like domain-containing protein -
  ABU981_RS15630 (ABU981_15630) - 3466276..3466644 (-) 369 WP_049257617.1 hypothetical protein -
  ABU981_RS15635 (ABU981_15635) - 3466641..3467009 (-) 369 WP_049257616.1 hypothetical protein -
  ABU981_RS15640 (ABU981_15640) - 3467011..3467352 (-) 342 WP_004247766.1 hypothetical protein -
  ABU981_RS15645 (ABU981_15645) - 3467352..3467750 (-) 399 WP_346836241.1 hypothetical protein -
  ABU981_RS15650 (ABU981_15650) - 3467807..3467980 (-) 174 WP_004247764.1 hypothetical protein -
  ABU981_RS15655 (ABU981_15655) - 3467990..3469084 (-) 1095 WP_161668582.1 major capsid protein -
  ABU981_RS15660 (ABU981_15660) - 3469100..3469546 (-) 447 WP_064497284.1 hypothetical protein -
  ABU981_RS15665 (ABU981_15665) - 3469546..3470820 (-) 1275 WP_210234502.1 hypothetical protein -
  ABU981_RS15670 (ABU981_15670) - 3470824..3471753 (-) 930 WP_063073747.1 phage minor head protein -
  ABU981_RS15675 (ABU981_15675) - 3471704..3473059 (-) 1356 WP_353629033.1 phage portal protein -
  ABU981_RS15680 (ABU981_15680) - 3473059..3474375 (-) 1317 WP_159287681.1 phage terminase large subunit -
  ABU981_RS15685 (ABU981_15685) - 3474359..3474784 (-) 426 WP_036905466.1 DNA-packaging protein -
  ABU981_RS15690 (ABU981_15690) - 3474801..3474983 (-) 183 WP_049199098.1 hypothetical protein -
  ABU981_RS15695 (ABU981_15695) - 3474976..3475158 (-) 183 WP_311747700.1 hypothetical protein -
  ABU981_RS15700 (ABU981_15700) - 3475165..3475323 (-) 159 WP_165439127.1 hypothetical protein -
  ABU981_RS15705 (ABU981_15705) - 3475320..3475736 (-) 417 WP_049199100.1 hypothetical protein -
  ABU981_RS15710 (ABU981_15710) - 3475736..3476272 (-) 537 WP_353629032.1 KilA-N domain-containing protein -
  ABU981_RS15715 (ABU981_15715) - 3476915..3477769 (-) 855 WP_115353735.1 DUF6236 family protein -
  ABU981_RS15720 (ABU981_15720) - 3478071..3478502 (-) 432 WP_226888982.1 lysis protein -
  ABU981_RS15725 (ABU981_15725) - 3478520..3478924 (-) 405 WP_088207137.1 structural protein -
  ABU981_RS15730 (ABU981_15730) - 3478917..3479273 (-) 357 WP_223878670.1 phage holin family protein -
  ABU981_RS15735 (ABU981_15735) - 3479705..3480208 (-) 504 WP_049199108.1 antiterminator Q family protein -
  ABU981_RS15740 (ABU981_15740) - 3480205..3480396 (-) 192 WP_049199110.1 hypothetical protein -
  ABU981_RS15745 (ABU981_15745) - 3480396..3481016 (-) 621 WP_049199112.1 recombination protein NinG -
  ABU981_RS15750 (ABU981_15750) - 3481290..3481733 (-) 444 WP_049199113.1 YbcN family protein -
  ABU981_RS15755 (ABU981_15755) - 3482069..3482326 (-) 258 WP_071233456.1 DUF551 domain-containing protein -
  ABU981_RS15760 (ABU981_15760) - 3482326..3482586 (-) 261 WP_049199119.1 hypothetical protein -
  ABU981_RS15765 (ABU981_15765) - 3482598..3482834 (-) 237 WP_049199120.1 hypothetical protein -
  ABU981_RS15770 (ABU981_15770) - 3482850..3483017 (-) 168 WP_152964332.1 hypothetical protein -
  ABU981_RS15775 (ABU981_15775) - 3483028..3483231 (-) 204 WP_049257592.1 hypothetical protein -
  ABU981_RS15780 (ABU981_15780) - 3483251..3484618 (-) 1368 WP_152691668.1 replicative DNA helicase -
  ABU981_RS15785 (ABU981_15785) - 3484622..3485458 (-) 837 WP_049257590.1 replication protein -
  ABU981_RS15790 (ABU981_15790) - 3485714..3486061 (-) 348 WP_161769471.1 hypothetical protein -
  ABU981_RS15795 (ABU981_15795) - 3486195..3486398 (-) 204 WP_156733177.1 transcriptional regulator -
  ABU981_RS15800 (ABU981_15800) - 3486517..3487227 (+) 711 WP_156733176.1 helix-turn-helix transcriptional regulator -
  ABU981_RS15805 (ABU981_15805) - 3487719..3487991 (+) 273 WP_107336920.1 hypothetical protein -
  ABU981_RS15810 (ABU981_15810) - 3488098..3488310 (-) 213 WP_004247471.1 hypothetical protein -
  ABU981_RS15815 (ABU981_15815) - 3488496..3488648 (+) 153 WP_004247470.1 hypothetical protein -
  ABU981_RS15820 (ABU981_15820) - 3488645..3488830 (-) 186 WP_004247469.1 hypothetical protein -
  ABU981_RS15825 (ABU981_15825) - 3488995..3489270 (+) 276 WP_004247467.1 hypothetical protein -
  ABU981_RS15830 (ABU981_15830) - 3489393..3489620 (+) 228 WP_004247466.1 hypothetical protein -
  ABU981_RS15835 (ABU981_15835) - 3489709..3489864 (+) 156 WP_162837622.1 hypothetical protein -
  ABU981_RS15840 (ABU981_15840) - 3489929..3490126 (+) 198 WP_353632705.1 hypothetical protein -
  ABU981_RS15845 (ABU981_15845) - 3490159..3490593 (+) 435 WP_350416899.1 SAM-dependent methyltransferase -
  ABU981_RS15850 (ABU981_15850) - 3490593..3490745 (+) 153 WP_170832173.1 hypothetical protein -
  ABU981_RS15855 (ABU981_15855) - 3490742..3491062 (+) 321 WP_074924238.1 hypothetical protein -
  ABU981_RS15860 (ABU981_15860) exoX 3491064..3491741 (+) 678 WP_161668557.1 exodeoxyribonuclease X -
  ABU981_RS15865 (ABU981_15865) - 3491734..3492351 (+) 618 WP_074924242.1 ERF family protein -
  ABU981_RS15870 (ABU981_15870) - 3492397..3492897 (+) 501 WP_201741347.1 HNH endonuclease signature motif containing protein -
  ABU981_RS15875 (ABU981_15875) ssb 3492897..3493427 (+) 531 WP_161668558.1 single-stranded DNA-binding protein Machinery gene
  ABU981_RS15880 (ABU981_15880) - 3493443..3493643 (+) 201 WP_049197573.1 hypothetical protein -
  ABU981_RS15885 (ABU981_15885) - 3493863..3494543 (+) 681 WP_036907944.1 hypothetical protein -
  ABU981_RS15890 (ABU981_15890) - 3494608..3494904 (+) 297 WP_036907943.1 hypothetical protein -
  ABU981_RS15895 (ABU981_15895) - 3494976..3495560 (+) 585 WP_036907942.1 hypothetical protein -
  ABU981_RS15900 (ABU981_15900) - 3495613..3495840 (+) 228 WP_036907941.1 hypothetical protein -
  ABU981_RS15905 (ABU981_15905) - 3495833..3496108 (+) 276 WP_036907940.1 hypothetical protein -
  ABU981_RS15910 (ABU981_15910) - 3496266..3496442 (+) 177 WP_162837621.1 hypothetical protein -
  ABU981_RS15915 (ABU981_15915) - 3496435..3496767 (+) 333 WP_353629030.1 phage protein NinX family protein -
  ABU981_RS15920 (ABU981_15920) - 3496754..3497356 (+) 603 WP_263055554.1 MT-A70 family methyltransferase -
  ABU981_RS15925 (ABU981_15925) - 3497569..3497760 (+) 192 WP_143475379.1 AlpA family phage regulatory protein -
  ABU981_RS15930 (ABU981_15930) - 3497741..3498916 (-) 1176 WP_161668680.1 site-specific integrase -
  ABU981_RS15935 (ABU981_15935) sbcB 3499094..3500524 (+) 1431 WP_143475377.1 exodeoxyribonuclease I -
  ABU981_RS15940 (ABU981_15940) - 3500686..3501675 (+) 990 WP_110706680.1 DUF4917 family protein -

Sequence


Protein


Download         Length: 176 a.a.        Molecular weight: 19505.90 Da        Isoelectric Point: 6.4659

>NTDB_id=1012545 ABU981_RS15875 WP_161668558.1 3492897..3493427(+) (ssb) [Proteus mirabilis strain 10035004-2]
MASRGVCKVILIGYLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWTDQNGQDRYTTEVVVNVGGTMQMLGGNQAGSQKSQQNQGWGQPQQPQAPKQSSSNQTPQSEPPMDFDDDIP
FAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 531 bp        

>NTDB_id=1012545 ABU981_RS15875 WP_161668558.1 3492897..3493427(+) (ssb) [Proteus mirabilis strain 10035004-2]
ATGGCAAGTCGTGGAGTATGTAAGGTGATCCTTATTGGCTACTTGGGGCAAGACCCTGAAATCCGTTATATGCCATCAGG
TGGCGCAGTAGCAAATCTCACATTGGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGGGTATGCATCTTCGGCAAATTAGCCGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAAGGTTCTCTGCAAACCAGAAAATGGACAGACCAGAACGGACAAGACCGATACACAACGGAAGTGGTAGTTAATGTCGG
TGGAACAATGCAGATGCTAGGTGGTAATCAGGCAGGAAGCCAGAAGTCACAGCAGAATCAAGGATGGGGACAGCCACAGC
AACCGCAAGCACCAAAACAATCATCGAGTAATCAAACACCACAAAGTGAACCTCCGATGGATTTCGATGACGACATCCCA
TTTGCCCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.797

100

0.682

  ssb Glaesserella parasuis strain SC1401

50.526

100

0.545

  ssb Neisseria gonorrhoeae MS11

43.182

100

0.432

  ssb Neisseria meningitidis MC58

43.182

100

0.432


Multiple sequence alignment