Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | LLUC023_RS11455 | Genome accession | NZ_CP158368 |
| Coordinates | 2232981..2233244 (-) | Length | 87 a.a. |
| NCBI ID | WP_021211201.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC023 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2226175..2253295 | 2232981..2233244 | within | 0 |
| IScluster/Tn | 2227111..2235320 | 2232981..2233244 | within | 0 |
Gene organization within MGE regions
Location: 2226175..2253295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC023_RS11415 (LLUC023_11425) | - | 2226175..2227047 (+) | 873 | WP_014573331.1 | RluA family pseudouridine synthase | - |
| LLUC023_RS11425 (LLUC023_11435) | - | 2228529..2229419 (-) | 891 | WP_396419884.1 | IS982-like element IS982B family transposase | - |
| LLUC023_RS11430 (LLUC023_11440) | - | 2229584..2230393 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC023_RS11435 (LLUC023_11445) | - | 2230386..2231123 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC023_RS11440 (LLUC023_11450) | - | 2231302..2232144 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC023_RS11445 (LLUC023_11455) | - | 2232141..2232578 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC023_RS11450 (LLUC023_11460) | comGG | 2232658..2232957 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC023_RS11455 (LLUC023_11465) | comGF | 2232981..2233244 (-) | 264 | WP_021211201.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC023_RS11460 (LLUC023_11470) | istB | 2233327..2234085 (-) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| LLUC023_RS11465 (LLUC023_11475) | istA | 2234097..2235320 (-) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLUC023_RS11470 (LLUC023_11480) | - | 2235376..2235498 (-) | 123 | WP_021211203.1 | hypothetical protein | - |
| LLUC023_RS11475 (LLUC023_11485) | - | 2235491..2235901 (-) | 411 | WP_011676523.1 | terminase | - |
| LLUC023_RS11480 (LLUC023_11490) | - | 2236343..2236765 (-) | 423 | WP_014573151.1 | RinA family protein | - |
| LLUC023_RS11485 (LLUC023_11495) | - | 2236843..2237151 (-) | 309 | WP_021211204.1 | hypothetical protein | - |
| LLUC023_RS11490 (LLUC023_11500) | - | 2237402..2237740 (-) | 339 | WP_021211205.1 | DUF1140 family protein | - |
| LLUC023_RS11495 (LLUC023_11505) | dut | 2237741..2238160 (-) | 420 | WP_282667355.1 | dUTP diphosphatase | - |
| LLUC023_RS11500 (LLUC023_11510) | - | 2238157..2238753 (-) | 597 | WP_151318410.1 | DUF1642 domain-containing protein | - |
| LLUC023_RS11505 (LLUC023_11515) | - | 2238746..2238952 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LLUC023_RS11510 (LLUC023_11520) | - | 2238966..2239490 (-) | 525 | WP_205288144.1 | hypothetical protein | - |
| LLUC023_RS11515 (LLUC023_11525) | - | 2239596..2239835 (-) | 240 | WP_021211207.1 | DUF1031 domain-containing protein | - |
| LLUC023_RS11520 (LLUC023_11530) | - | 2239836..2240255 (-) | 420 | WP_021165554.1 | hypothetical protein | - |
| LLUC023_RS11525 (LLUC023_11535) | - | 2240245..2240466 (-) | 222 | WP_021211208.1 | hypothetical protein | - |
| LLUC023_RS11530 (LLUC023_11540) | - | 2240447..2241256 (-) | 810 | WP_021211209.1 | helix-turn-helix domain-containing protein | - |
| LLUC023_RS11535 (LLUC023_11545) | - | 2241483..2242550 (-) | 1068 | WP_021211210.1 | DUF1351 domain-containing protein | - |
| LLUC023_RS11540 (LLUC023_11550) | bet | 2242552..2243289 (-) | 738 | WP_021211211.1 | phage recombination protein Bet | - |
| LLUC023_RS11545 (LLUC023_11555) | - | 2243376..2244266 (-) | 891 | WP_332371208.1 | IS982-like element ISLll1 family transposase | - |
| LLUC023_RS11550 (LLUC023_11560) | - | 2244418..2244633 (-) | 216 | WP_010905687.1 | DUF1408 domain-containing protein | - |
| LLUC023_RS11555 (LLUC023_11565) | - | 2244736..2245014 (+) | 279 | WP_011834777.1 | hypothetical protein | - |
| LLUC023_RS11560 (LLUC023_11570) | - | 2244969..2245202 (-) | 234 | WP_011834776.1 | hypothetical protein | - |
| LLUC023_RS11565 (LLUC023_11575) | - | 2245547..2246290 (-) | 744 | WP_031298611.1 | ORF6C domain-containing protein | - |
| LLUC023_RS11570 (LLUC023_11580) | - | 2246305..2246535 (-) | 231 | WP_011676017.1 | hypothetical protein | - |
| LLUC023_RS11575 (LLUC023_11585) | - | 2246825..2247172 (+) | 348 | WP_031298613.1 | XRE family transcriptional regulator | - |
| LLUC023_RS11580 (LLUC023_11590) | - | 2247201..2247764 (+) | 564 | WP_021211213.1 | hypothetical protein | - |
| LLUC023_RS11585 (LLUC023_11595) | - | 2247776..2247976 (+) | 201 | WP_021211214.1 | hypothetical protein | - |
| LLUC023_RS11590 (LLUC023_11600) | - | 2248052..2248489 (+) | 438 | WP_259751086.1 | DUF6978 family protein | - |
| LLUC023_RS11595 (LLUC023_11605) | - | 2248515..2249306 (+) | 792 | WP_205288149.1 | DUF1829 domain-containing protein | - |
| LLUC023_RS11600 (LLUC023_11610) | - | 2249424..2250881 (+) | 1458 | WP_205288150.1 | recombinase family protein | - |
| LLUC023_RS11605 (LLUC023_11615) | comGC | 2250878..2251012 (-) | 135 | WP_021211216.1 | hypothetical protein | Machinery gene |
| LLUC023_RS11610 (LLUC023_11620) | comGB | 2251030..2251479 (-) | 450 | WP_021211217.1 | type II secretion system F family protein | Machinery gene |
| LLUC023_RS11615 (LLUC023_11625) | - | 2251576..2252751 (+) | 1176 | WP_003138385.1 | IS256-like element IS905 family transposase | - |
| LLUC023_RS11620 (LLUC023_11630) | comGB | 2252798..2253283 (-) | 486 | WP_242515029.1 | type II secretion system F family protein | Machinery gene |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 10030.36 Da Isoelectric Point: 8.3880
>NTDB_id=1011028 LLUC023_RS11455 WP_021211201.1 2232981..2233244(-) (comGF) [Lactococcus cremoris strain UC023]
MTRSELSGAKLDNVNQNFLYVTKDKKLRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFI
YRFTDTK
MTRSELSGAKLDNVNQNFLYVTKDKKLRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFI
YRFTDTK
Nucleotide
Download Length: 264 bp
>NTDB_id=1011028 LLUC023_RS11455 WP_021211201.1 2232981..2233244(-) (comGF) [Lactococcus cremoris strain UC023]
TTGACACGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAGTT
ACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTTAA
AAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTATT
TATCGATTTACTGATACAAAGTAA
TTGACACGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAGTT
ACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTTAA
AAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTATT
TATCGATTTACTGATACAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Lactococcus lactis subsp. cremoris KW2 |
100 |
97.701 |
0.977 |
| comYF | Streptococcus mutans UA140 |
42.353 |
97.701 |
0.414 |
| comGF/cglF | Streptococcus mitis SK321 |
40.698 |
98.851 |
0.402 |
| comYF | Streptococcus mutans UA159 |
41.176 |
97.701 |
0.402 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
39.535 |
98.851 |
0.391 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
40 |
97.701 |
0.391 |
| comGF/cglF | Streptococcus pneumoniae D39 |
40 |
97.701 |
0.391 |
| comGF/cglF | Streptococcus pneumoniae R6 |
40 |
97.701 |
0.391 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
40 |
97.701 |
0.391 |