Detailed information NTG1010864

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ABOE65_RS11785
• Genome accession: NZ_CP158358
• Coordinates: 2412016..2412453 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain HY23
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2407016..2417453

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABOE65_RS11735 (ABOE65_11725)	sinI	2407400..2407573 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ABOE65_RS11740 (ABOE65_11730)	sinR	2407607..2407942 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ABOE65_RS11745 (ABOE65_11735)	-	2407990..2408775 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ABOE65_RS11750 (ABOE65_11740)	-	2408840..2409424 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ABOE65_RS11755 (ABOE65_11745)	tapA	2409396..2410067 (-)	672	WP_012117978.1	amyloid fiber anchoring/assembly protein TapA	-
ABOE65_RS11760 (ABOE65_11750)	-	2410326..2410655 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
ABOE65_RS11765 (ABOE65_11755)	-	2410695..2410874 (-)	180	WP_003153093.1	YqzE family protein	-
ABOE65_RS11770 (ABOE65_11760)	comGG	2410931..2411308 (-)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
ABOE65_RS11775 (ABOE65_11765)	comGF	2411309..2411809 (-)	501	WP_012117981.1	competence type IV pilus minor pilin ComGF	-
ABOE65_RS11780 (ABOE65_11770)	comGE	2411718..2412032 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ABOE65_RS11785 (ABOE65_11775)	comGD	2412016..2412453 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ABOE65_RS11790 (ABOE65_11780)	comGC	2412443..2412751 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ABOE65_RS11795 (ABOE65_11785)	comGB	2412756..2413793 (-)	1038	WP_012117984.1	competence type IV pilus assembly protein ComGB	Machinery gene
ABOE65_RS11800 (ABOE65_11790)	comGA	2413780..2414850 (-)	1071	WP_012117985.1	competence type IV pilus ATPase ComGA	Machinery gene
ABOE65_RS11805 (ABOE65_11795)	-	2415047..2415997 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
ABOE65_RS11810 (ABOE65_11800)	-	2416143..2417444 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1010864 ABOE65_RS11785 WP_012117983.1 2412016..2412453(-) (comGD) [Bacillus velezensis strain HY23]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1010864 ABOE65_RS11785 WP_012117983.1 2412016..2412453(-) (comGD) [Bacillus velezensis strain HY23]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572