Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABOE65_RS11735 | Genome accession | NZ_CP158358 |
| Coordinates | 2407400..2407573 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain HY23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2402400..2412573
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABOE65_RS11720 (ABOE65_11710) | gcvT | 2403213..2404313 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABOE65_RS11725 (ABOE65_11715) | - | 2404737..2406407 (+) | 1671 | WP_012117975.1 | SNF2-related protein | - |
| ABOE65_RS11730 (ABOE65_11720) | - | 2406429..2407223 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| ABOE65_RS11735 (ABOE65_11725) | sinI | 2407400..2407573 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ABOE65_RS11740 (ABOE65_11730) | sinR | 2407607..2407942 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABOE65_RS11745 (ABOE65_11735) | - | 2407990..2408775 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ABOE65_RS11750 (ABOE65_11740) | - | 2408840..2409424 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ABOE65_RS11755 (ABOE65_11745) | tapA | 2409396..2410067 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABOE65_RS11760 (ABOE65_11750) | - | 2410326..2410655 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ABOE65_RS11765 (ABOE65_11755) | - | 2410695..2410874 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ABOE65_RS11770 (ABOE65_11760) | comGG | 2410931..2411308 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABOE65_RS11775 (ABOE65_11765) | comGF | 2411309..2411809 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| ABOE65_RS11780 (ABOE65_11770) | comGE | 2411718..2412032 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ABOE65_RS11785 (ABOE65_11775) | comGD | 2412016..2412453 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1010861 ABOE65_RS11735 WP_003153105.1 2407400..2407573(+) (sinI) [Bacillus velezensis strain HY23]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1010861 ABOE65_RS11735 WP_003153105.1 2407400..2407573(+) (sinI) [Bacillus velezensis strain HY23]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |