Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABOE65_RS11770 Genome accession   NZ_CP158358
Coordinates   2410931..2411308 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain HY23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2405931..2416308
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABOE65_RS11730 (ABOE65_11720) - 2406429..2407223 (+) 795 WP_012117976.1 YqhG family protein -
  ABOE65_RS11735 (ABOE65_11725) sinI 2407400..2407573 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABOE65_RS11740 (ABOE65_11730) sinR 2407607..2407942 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABOE65_RS11745 (ABOE65_11735) - 2407990..2408775 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ABOE65_RS11750 (ABOE65_11740) - 2408840..2409424 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ABOE65_RS11755 (ABOE65_11745) tapA 2409396..2410067 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  ABOE65_RS11760 (ABOE65_11750) - 2410326..2410655 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABOE65_RS11765 (ABOE65_11755) - 2410695..2410874 (-) 180 WP_003153093.1 YqzE family protein -
  ABOE65_RS11770 (ABOE65_11760) comGG 2410931..2411308 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABOE65_RS11775 (ABOE65_11765) comGF 2411309..2411809 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  ABOE65_RS11780 (ABOE65_11770) comGE 2411718..2412032 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ABOE65_RS11785 (ABOE65_11775) comGD 2412016..2412453 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABOE65_RS11790 (ABOE65_11780) comGC 2412443..2412751 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABOE65_RS11795 (ABOE65_11785) comGB 2412756..2413793 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABOE65_RS11800 (ABOE65_11790) comGA 2413780..2414850 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ABOE65_RS11805 (ABOE65_11795) - 2415047..2415997 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1010863 ABOE65_RS11770 WP_012117980.1 2410931..2411308(-) (comGG) [Bacillus velezensis strain HY23]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1010863 ABOE65_RS11770 WP_012117980.1 2410931..2411308(-) (comGG) [Bacillus velezensis strain HY23]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment