Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H1X08_RS01570 Genome accession   NZ_LR822025
Coordinates   296803..297042 (+) Length   79 a.a.
NCBI ID   WP_021152514.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_961     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 291803..302042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1X08_RS01540 (STHERMO_0319) - 292330..293067 (-) 738 WP_180482400.1 LytR/AlgR family response regulator transcription factor -
  H1X08_RS01545 (STHERMO_0320) - 293318..293494 (+) 177 WP_180482401.1 Blp family class II bacteriocin -
  H1X08_RS01550 (STHERMO_0321) - 293513..293713 (+) 201 WP_011681569.1 hypothetical protein -
  H1X08_RS01555 (STHERMO_0322) - 294069..294299 (+) 231 WP_011226494.1 bacteriocin class II family protein -
  H1X08_RS01560 (STHERMO_0323) - 294306..294467 (+) 162 WP_011681568.1 hypothetical protein -
  H1X08_RS11190 - 295323..295724 (+) 402 WP_011226490.1 hypothetical protein -
  H1X08_RS01565 (STHERMO_0328) - 295975..296217 (+) 243 WP_180482402.1 Blp family class II bacteriocin -
  H1X08_RS01570 (STHERMO_0331) cipB 296803..297042 (+) 240 WP_021152514.1 Blp family class II bacteriocin Regulator
  H1X08_RS01575 - 297054..297446 (+) 393 WP_084829084.1 hypothetical protein -
  H1X08_RS01580 (STHERMO_0332) - 297475..297654 (+) 180 WP_011681564.1 hypothetical protein -
  H1X08_RS01585 (STHERMO_0333) - 297841..298767 (+) 927 WP_022096485.1 thioredoxin family protein -
  H1X08_RS01590 (STHERMO_0334) - 298932..299228 (+) 297 WP_180482403.1 bacteriocin immunity protein -
  H1X08_RS01595 - 299550..299813 (+) 264 WP_002945924.1 hypothetical protein -
  H1X08_RS01600 (STHERMO_0337) - 299938..300318 (+) 381 WP_180482404.1 bacteriocin secretion protein -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7695.63 Da        Isoelectric Point: 3.8735

>NTDB_id=1010153 H1X08_RS01570 WP_021152514.1 296803..297042(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_961]
MATQTIENFNTLDLETLASVEGGRVNWERWGVCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=1010153 H1X08_RS01570 WP_021152514.1 296803..297042(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_961]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAGTGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment