Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXR36_RS05280 Genome accession   NZ_CP157773
Coordinates   1086071..1086541 (+) Length   156 a.a.
NCBI ID   WP_029549393.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN89     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1076342..1118262 1086071..1086541 within 0


Gene organization within MGE regions


Location: 1076342..1118262
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXR36_RS05200 (UXR36_005200) - 1076342..1077727 (-) 1386 WP_047230699.1 recombinase family protein -
  UXR36_RS05205 (UXR36_005205) - 1077920..1078624 (-) 705 WP_017804779.1 type II toxin-antitoxin system PemK/MazF family toxin -
  UXR36_RS05210 (UXR36_005210) - 1078660..1078845 (-) 186 WP_024936996.1 hypothetical protein -
  UXR36_RS05215 (UXR36_005215) - 1078842..1078988 (-) 147 WP_001049401.1 hypothetical protein -
  UXR36_RS05220 (UXR36_005220) - 1079000..1079722 (-) 723 WP_024936995.1 XRE family transcriptional regulator -
  UXR36_RS05225 (UXR36_005225) - 1079864..1080082 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  UXR36_RS05230 (UXR36_005230) - 1080098..1080886 (+) 789 WP_047230698.1 phage antirepressor KilAC domain-containing protein -
  UXR36_RS05235 (UXR36_005235) - 1080903..1081097 (+) 195 WP_047230697.1 hypothetical protein -
  UXR36_RS05240 (UXR36_005240) - 1081301..1081531 (-) 231 WP_000395457.1 hypothetical protein -
  UXR36_RS05245 (UXR36_005245) - 1081581..1081718 (+) 138 WP_000230552.1 hypothetical protein -
  UXR36_RS05250 (UXR36_005250) - 1081711..1081872 (+) 162 WP_000066026.1 DUF1270 family protein -
  UXR36_RS05255 (UXR36_005255) - 1081966..1082226 (+) 261 WP_000291090.1 DUF1108 family protein -
  UXR36_RS05260 (UXR36_005260) - 1082235..1082498 (+) 264 WP_001205732.1 hypothetical protein -
  UXR36_RS05265 (UXR36_005265) - 1082507..1084450 (+) 1944 WP_031762972.1 AAA family ATPase -
  UXR36_RS05270 (UXR36_005270) - 1084452..1085372 (+) 921 WP_000138475.1 recombinase RecT -
  UXR36_RS05275 (UXR36_005275) - 1085453..1086070 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  UXR36_RS05280 (UXR36_005280) ssbA 1086071..1086541 (+) 471 WP_029549393.1 single-stranded DNA-binding protein Machinery gene
  UXR36_RS05285 (UXR36_005285) - 1086571..1087455 (+) 885 WP_031873996.1 DnaD domain protein -
  UXR36_RS05290 (UXR36_005290) - 1087462..1087680 (+) 219 WP_000338528.1 hypothetical protein -
  UXR36_RS05295 (UXR36_005295) - 1087689..1088093 (+) 405 WP_070869111.1 RusA family crossover junction endodeoxyribonuclease -
  UXR36_RS05300 (UXR36_005300) - 1088106..1088477 (+) 372 WP_061650592.1 SA1788 family PVL leukocidin-associated protein -
  UXR36_RS05305 (UXR36_005305) - 1088478..1088726 (+) 249 WP_001126839.1 phi PVL orf 51-like protein -
  UXR36_RS05310 (UXR36_005310) - 1088790..1089137 (+) 348 WP_000982695.1 YopX family protein -
  UXR36_RS05315 (UXR36_005315) - 1089134..1089523 (+) 390 WP_070869110.1 acetyltransferase -
  UXR36_RS05320 (UXR36_005320) - 1089516..1089770 (+) 255 WP_001065084.1 DUF1024 family protein -
  UXR36_RS05325 (UXR36_005325) - 1089757..1089927 (+) 171 WP_000714409.1 hypothetical protein -
  UXR36_RS05330 (UXR36_005330) - 1089920..1090453 (+) 534 WP_000185642.1 dUTP pyrophosphatase -
  UXR36_RS05335 (UXR36_005335) - 1090490..1090777 (+) 288 WP_000195801.1 DUF1381 domain-containing protein -
  UXR36_RS05340 (UXR36_005340) - 1090770..1091005 (+) 236 Protein_1045 hypothetical protein -
  UXR36_RS05345 (UXR36_005345) - 1090995..1091384 (+) 390 WP_025174390.1 hypothetical protein -
  UXR36_RS05350 (UXR36_005350) - 1091381..1091554 (+) 174 WP_000595303.1 transcriptional activator RinB -
  UXR36_RS05355 (UXR36_005355) - 1091555..1091956 (+) 402 WP_000286968.1 hypothetical protein -
  UXR36_RS05360 (UXR36_005360) - 1092308..1092802 (+) 495 WP_000594087.1 terminase small subunit -
  UXR36_RS05365 (UXR36_005365) - 1092795..1094018 (+) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  UXR36_RS05370 (UXR36_005370) - 1094015..1095439 (+) 1425 WP_000177422.1 phage portal protein -
  UXR36_RS05375 (UXR36_005375) - 1095408..1096361 (+) 954 WP_000184133.1 phage head morphogenesis protein -
  UXR36_RS05380 (UXR36_005380) - 1096363..1096569 (+) 207 WP_000346033.1 hypothetical protein -
  UXR36_RS05385 (UXR36_005385) - 1096672..1097256 (+) 585 WP_001019219.1 DUF4355 domain-containing protein -
  UXR36_RS05390 (UXR36_005390) - 1097273..1098187 (+) 915 WP_000235168.1 phage major capsid protein -
  UXR36_RS05395 (UXR36_005395) - 1098199..1098342 (+) 144 WP_000002931.1 hypothetical protein -
  UXR36_RS05400 (UXR36_005400) - 1098348..1098698 (+) 351 WP_000177351.1 phage head-tail adapter protein -
  UXR36_RS05405 (UXR36_005405) - 1098710..1099045 (+) 336 WP_000483041.1 phage head closure protein -
  UXR36_RS05410 (UXR36_005410) - 1099032..1099445 (+) 414 WP_001151330.1 HK97-gp10 family putative phage morphogenesis protein -
  UXR36_RS05415 (UXR36_005415) - 1099458..1099883 (+) 426 WP_000270192.1 DUF3168 domain-containing protein -
  UXR36_RS05420 (UXR36_005420) - 1099884..1100441 (+) 558 WP_000057582.1 tail protein -
  UXR36_RS05425 (UXR36_005425) - 1100508..1101014 (+) 507 WP_061839760.1 tail assembly chaperone -
  UXR36_RS05430 (UXR36_005430) - 1101059..1101343 (+) 285 WP_000880587.1 hypothetical protein -
  UXR36_RS05435 (UXR36_005435) - 1101347..1104490 (+) 3144 WP_070869108.1 terminase -
  UXR36_RS05440 (UXR36_005440) - 1104505..1105446 (+) 942 WP_015984522.1 phage tail domain-containing protein -
  UXR36_RS05445 (UXR36_005445) - 1105457..1107343 (+) 1887 WP_001122001.1 SGNH/GDSL hydrolase family protein -
  UXR36_RS05450 (UXR36_005450) - 1107356..1109254 (+) 1899 WP_033861309.1 hypothetical protein -
  UXR36_RS05455 (UXR36_005455) - 1109254..1111077 (+) 1824 WP_336389720.1 BppU family phage baseplate upper protein -
  UXR36_RS05460 (UXR36_005460) - 1111077..1111454 (+) 378 WP_000705914.1 DUF2977 domain-containing protein -
  UXR36_RS05465 (UXR36_005465) - 1111464..1111637 (+) 174 WP_001790193.1 XkdX family protein -
  UXR36_RS05470 (UXR36_005470) - 1111678..1111977 (+) 300 WP_000466784.1 DUF2951 domain-containing protein -
  UXR36_RS05475 (UXR36_005475) - 1112114..1113988 (+) 1875 WP_033861356.1 glucosaminidase domain-containing protein -
  UXR36_RS05480 (UXR36_005480) - 1114001..1115173 (+) 1173 WP_015978297.1 BppU family phage baseplate upper protein -
  UXR36_RS05485 (UXR36_005485) - 1115179..1115574 (+) 396 WP_000398878.1 hypothetical protein -
  UXR36_RS05490 (UXR36_005490) - 1115630..1116067 (+) 438 WP_000354128.1 phage holin -
  UXR36_RS05495 (UXR36_005495) - 1116048..1117493 (+) 1446 WP_061641004.1 SH3 domain-containing protein -
  UXR36_RS05500 (UXR36_005500) - 1117742..1117894 (+) 153 WP_078103528.1 hypothetical protein -
  UXR36_RS05505 (UXR36_005505) - 1117965..1118075 (+) 111 WP_031922866.1 hypothetical protein -
  UXR36_RS05510 (UXR36_005510) - 1118077..1118262 (+) 186 WP_001286804.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17654.38 Da        Isoelectric Point: 4.6228

>NTDB_id=1008255 UXR36_RS05280 WP_029549393.1 1086071..1086541(+) (ssbA) [Staphylococcus aureus strain BSN89]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1008255 UXR36_RS05280 WP_029549393.1 1086071..1086541(+) (ssbA) [Staphylococcus aureus strain BSN89]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.017

100

0.692

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment