Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXQ45_RS11015 Genome accession   NZ_CP157420
Coordinates   2172514..2172984 (-) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain BSN48-2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2142195..2194383 2172514..2172984 within 0


Gene organization within MGE regions


Location: 2142195..2194383
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXQ45_RS10800 (UXQ45_010800) scn 2142195..2142545 (-) 351 WP_000702262.1 complement inhibitor SCIN-A -
  UXQ45_RS10805 (UXQ45_010805) - 2143228..2143678 (+) 451 Protein_2095 chemotaxis-inhibiting protein CHIPS -
  UXQ45_RS10810 (UXQ45_010810) - 2143773..2144107 (-) 335 Protein_2096 SH3 domain-containing protein -
  UXQ45_RS10815 (UXQ45_010815) sak 2144754..2145245 (-) 492 WP_000920042.1 staphylokinase -
  UXQ45_RS10820 (UXQ45_010820) - 2145436..2146191 (-) 756 WP_000861026.1 CHAP domain-containing protein -
  UXQ45_RS10825 (UXQ45_010825) - 2146203..2146457 (-) 255 WP_000611512.1 phage holin -
  UXQ45_RS10830 (UXQ45_010830) - 2146509..2146616 (+) 108 WP_031762631.1 hypothetical protein -
  UXQ45_RS10835 (UXQ45_010835) pepG1 2146669..2146803 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  UXQ45_RS10840 (UXQ45_010840) sep 2147048..2147830 (-) 783 WP_000034846.1 staphylococcal enterotoxin type P -
  UXQ45_RS10845 (UXQ45_010845) - 2148242..2148616 (-) 375 WP_000340977.1 hypothetical protein -
  UXQ45_RS10850 (UXQ45_010850) - 2148672..2148959 (-) 288 WP_001262621.1 hypothetical protein -
  UXQ45_RS10855 (UXQ45_010855) - 2149005..2149157 (-) 153 WP_001000058.1 hypothetical protein -
  UXQ45_RS10860 (UXQ45_010860) - 2149150..2152932 (-) 3783 WP_000582152.1 phage tail spike protein -
  UXQ45_RS10865 (UXQ45_010865) - 2152948..2154432 (-) 1485 WP_000567396.1 phage tail domain-containing protein -
  UXQ45_RS10870 (UXQ45_010870) - 2154429..2158958 (-) 4530 WP_000504568.1 phage tail tape measure protein -
  UXQ45_RS10875 (UXQ45_010875) - 2159015..2159152 (-) 138 WP_001549167.1 hypothetical protein -
  UXQ45_RS10880 (UXQ45_010880) - 2159203..2159553 (-) 351 WP_001096355.1 hypothetical protein -
  UXQ45_RS10885 (UXQ45_010885) - 2159603..2159833 (-) 231 Protein_2111 Ig-like domain-containing protein -
  UXQ45_RS10890 (UXQ45_010890) - 2159869..2160513 (-) 645 WP_000268740.1 major tail protein -
  UXQ45_RS10895 (UXQ45_010895) - 2160514..2160921 (-) 408 WP_000565498.1 hypothetical protein -
  UXQ45_RS10900 (UXQ45_010900) - 2160918..2161322 (-) 405 WP_000114226.1 HK97 gp10 family phage protein -
  UXQ45_RS10905 (UXQ45_010905) - 2161319..2161681 (-) 363 WP_000755150.1 head-tail adaptor protein -
  UXQ45_RS10910 (UXQ45_010910) - 2161665..2161949 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  UXQ45_RS10915 (UXQ45_010915) - 2161939..2162223 (-) 285 WP_000238236.1 hypothetical protein -
  UXQ45_RS10920 (UXQ45_010920) - 2162243..2163388 (-) 1146 WP_000154559.1 phage major capsid protein -
  UXQ45_RS10925 (UXQ45_010925) - 2163412..2164149 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  UXQ45_RS10930 (UXQ45_010930) - 2164133..2165320 (-) 1188 WP_000025274.1 phage portal protein -
  UXQ45_RS10935 (UXQ45_010935) - 2165336..2166997 (-) 1662 WP_000625088.1 terminase large subunit -
  UXQ45_RS10940 (UXQ45_010940) - 2166994..2167338 (-) 345 WP_000402904.1 hypothetical protein -
  UXQ45_RS10945 (UXQ45_010945) - 2167468..2167767 (-) 300 WP_000988332.1 HNH endonuclease -
  UXQ45_RS10950 (UXQ45_010950) - 2167999..2168415 (-) 417 WP_000590122.1 hypothetical protein -
  UXQ45_RS10955 (UXQ45_010955) - 2168443..2168643 (-) 201 WP_001557462.1 DUF1514 family protein -
  UXQ45_RS10960 (UXQ45_010960) - 2168643..2168792 (-) 150 WP_000595265.1 transcriptional activator RinB -
  UXQ45_RS10965 (UXQ45_010965) - 2168789..2168995 (-) 207 WP_000195784.1 DUF1381 domain-containing protein -
  UXQ45_RS10970 (UXQ45_010970) - 2168992..2169237 (-) 246 WP_001282071.1 hypothetical protein -
  UXQ45_RS10975 (UXQ45_010975) - 2169274..2169810 (-) 537 WP_000185693.1 dUTPase -
  UXQ45_RS10980 (UXQ45_010980) - 2169807..2170052 (-) 246 WP_001065108.1 DUF1024 family protein -
  UXQ45_RS10985 (UXQ45_010985) - 2170067..2170315 (-) 249 WP_000178987.1 SAV1978 family virulence-associated passenger protein -
  UXQ45_RS10990 (UXQ45_010990) - 2170312..2170569 (-) 258 WP_000111491.1 DUF3310 domain-containing protein -
  UXQ45_RS10995 (UXQ45_010995) - 2170569..2170940 (-) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  UXQ45_RS11000 (UXQ45_011000) - 2170953..2171357 (-) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  UXQ45_RS11005 (UXQ45_011005) - 2171366..2171584 (-) 219 WP_000338528.1 hypothetical protein -
  UXQ45_RS11010 (UXQ45_011010) - 2171591..2172484 (-) 894 WP_000148333.1 DnaD domain-containing protein -
  UXQ45_RS11015 (UXQ45_011015) ssbA 2172514..2172984 (-) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  UXQ45_RS11020 (UXQ45_011020) - 2172985..2173602 (-) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  UXQ45_RS11025 (UXQ45_011025) - 2173683..2174603 (-) 921 WP_000180600.1 recombinase RecT -
  UXQ45_RS11030 (UXQ45_011030) - 2174605..2176548 (-) 1944 WP_000700555.1 AAA family ATPase -
  UXQ45_RS11035 (UXQ45_011035) - 2176557..2176820 (-) 264 WP_001205732.1 hypothetical protein -
  UXQ45_RS11040 (UXQ45_011040) - 2176829..2177089 (-) 261 WP_000291510.1 DUF1108 family protein -
  UXQ45_RS11045 (UXQ45_011045) - 2177094..2177396 (-) 303 WP_000165371.1 DUF2482 family protein -
  UXQ45_RS11050 (UXQ45_011050) - 2177491..2177652 (-) 162 WP_000048129.1 DUF1270 family protein -
  UXQ45_RS11055 (UXQ45_011055) - 2177649..2177972 (-) 324 WP_001120201.1 DUF771 domain-containing protein -
  UXQ45_RS11060 (UXQ45_011060) - 2178027..2178407 (+) 381 WP_000762521.1 DUF2513 domain-containing protein -
  UXQ45_RS11065 (UXQ45_011065) - 2178394..2178591 (-) 198 WP_001148856.1 hypothetical protein -
  UXQ45_RS11070 (UXQ45_011070) - 2178607..2179359 (-) 753 WP_001148605.1 phage antirepressor KilAC domain-containing protein -
  UXQ45_RS11075 (UXQ45_011075) - 2179410..2179739 (+) 330 WP_000128909.1 hypothetical protein -
  UXQ45_RS11080 (UXQ45_011080) - 2179728..2179943 (-) 216 WP_001025404.1 MW1434 family type I TA system toxin -
  UXQ45_RS11085 (UXQ45_011085) - 2179959..2180222 (-) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  UXQ45_RS11090 (UXQ45_011090) - 2180219..2180393 (-) 175 Protein_2152 transcriptional regulator -
  UXQ45_RS11095 (UXQ45_011095) - 2180356..2181069 (+) 714 WP_001031454.1 XRE family transcriptional regulator -
  UXQ45_RS11100 (UXQ45_011100) - 2181085..2182017 (+) 933 WP_000759682.1 exonuclease domain-containing protein -
  UXQ45_RS11105 (UXQ45_011105) - 2182023..2182364 (+) 342 WP_000591749.1 hypothetical protein -
  UXQ45_RS11110 (UXQ45_011110) - 2182568..2182750 (+) 183 WP_000694772.1 hypothetical protein -
  UXQ45_RS11115 (UXQ45_011115) - 2182850..2183833 (+) 984 WP_001558608.1 glycosyltransferase family 2 protein -
  UXQ45_RS11120 (UXQ45_011120) - 2183844..2184086 (+) 243 WP_000427213.1 hypothetical protein -
  UXQ45_RS11125 (UXQ45_011125) - 2184149..2185186 (+) 1038 WP_000857180.1 site-specific integrase -
  UXQ45_RS11130 (UXQ45_011130) sph 2185237..2186067 (+) 831 Protein_2160 sphingomyelin phosphodiesterase -
  UXQ45_RS11135 (UXQ45_011135) lukG 2186305..2187321 (-) 1017 WP_000595396.1 bi-component leukocidin LukGH subunit G -
  UXQ45_RS11140 (UXQ45_011140) lukH 2187343..2188398 (-) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  UXQ45_RS11145 (UXQ45_011145) - 2188834..2190057 (+) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  UXQ45_RS11150 (UXQ45_011150) - 2190560..2191867 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  UXQ45_RS11155 (UXQ45_011155) groL 2192407..2194023 (-) 1617 WP_000240642.1 chaperonin GroEL -
  UXQ45_RS11160 (UXQ45_011160) groES 2194099..2194383 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1006735 UXQ45_RS11015 WP_000934759.1 2172514..2172984(-) (ssbA) [Staphylococcus aureus strain BSN48-2]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1006735 UXQ45_RS11015 WP_000934759.1 2172514..2172984(-) (ssbA) [Staphylococcus aureus strain BSN48-2]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment