Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXQ45_RS05440 Genome accession   NZ_CP157420
Coordinates   1119328..1119798 (+) Length   156 a.a.
NCBI ID   WP_029549393.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN48-2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1108787..1150847 1119328..1119798 within 0


Gene organization within MGE regions


Location: 1108787..1150847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXQ45_RS05345 (UXQ45_005345) - 1108787..1110172 (-) 1386 WP_000861313.1 recombinase family protein -
  UXQ45_RS05350 (UXQ45_005350) - 1110379..1110501 (-) 123 WP_001077637.1 hypothetical protein -
  UXQ45_RS05355 (UXQ45_005355) - 1110522..1110983 (-) 462 WP_000525016.1 hypothetical protein -
  UXQ45_RS05360 (UXQ45_005360) - 1110996..1111319 (-) 324 WP_001260487.1 helix-turn-helix transcriptional regulator -
  UXQ45_RS05365 (UXQ45_005365) - 1111483..1111731 (+) 249 WP_000272858.1 helix-turn-helix transcriptional regulator -
  UXQ45_RS05370 (UXQ45_005370) - 1111747..1112535 (+) 789 WP_001148566.1 phage antirepressor KilAC domain-containing protein -
  UXQ45_RS05375 (UXQ45_005375) - 1112552..1112710 (+) 159 WP_000398750.1 hypothetical protein -
  UXQ45_RS05380 (UXQ45_005380) - 1112685..1113014 (-) 330 WP_000514498.1 hypothetical protein -
  UXQ45_RS05385 (UXQ45_005385) - 1113071..1113847 (+) 777 WP_001148542.1 Rha family transcriptional regulator -
  UXQ45_RS05390 (UXQ45_005390) - 1113911..1114069 (+) 159 WP_223200610.1 pathogenicity island protein -
  UXQ45_RS05395 (UXQ45_005395) - 1114260..1114490 (-) 231 WP_000395455.1 hypothetical protein -
  UXQ45_RS05400 (UXQ45_005400) - 1114540..1114677 (+) 138 WP_000230552.1 hypothetical protein -
  UXQ45_RS05405 (UXQ45_005405) - 1114670..1114840 (+) 171 WP_001837399.1 DUF1270 domain-containing protein -
  UXQ45_RS05410 (UXQ45_005410) - 1114821..1115159 (+) 339 WP_015990309.1 transcriptional regulator -
  UXQ45_RS05415 (UXQ45_005415) - 1115223..1115483 (+) 261 WP_001837398.1 DUF1108 family protein -
  UXQ45_RS05420 (UXQ45_005420) - 1115492..1115755 (+) 264 WP_001205732.1 hypothetical protein -
  UXQ45_RS05425 (UXQ45_005425) - 1115764..1117707 (+) 1944 WP_061643880.1 AAA family ATPase -
  UXQ45_RS05430 (UXQ45_005430) - 1117709..1118629 (+) 921 WP_000138475.1 recombinase RecT -
  UXQ45_RS05435 (UXQ45_005435) - 1118710..1119327 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  UXQ45_RS05440 (UXQ45_005440) ssbA 1119328..1119798 (+) 471 WP_029549393.1 single-stranded DNA-binding protein Machinery gene
  UXQ45_RS05445 (UXQ45_005445) - 1119828..1120712 (+) 885 WP_271321815.1 DnaD domain protein -
  UXQ45_RS05450 (UXQ45_005450) - 1120719..1120937 (+) 219 WP_000338528.1 hypothetical protein -
  UXQ45_RS05455 (UXQ45_005455) - 1120946..1121350 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  UXQ45_RS05460 (UXQ45_005460) - 1121363..1121734 (+) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  UXQ45_RS05465 (UXQ45_005465) - 1121734..1121991 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  UXQ45_RS05470 (UXQ45_005470) - 1121988..1122236 (+) 249 WP_000178987.1 SAV1978 family virulence-associated passenger protein -
  UXQ45_RS05475 (UXQ45_005475) - 1122248..1122415 (+) 168 WP_001624242.1 hypothetical protein -
  UXQ45_RS05480 (UXQ45_005480) - 1122408..1122659 (+) 252 WP_001065091.1 DUF1024 family protein -
  UXQ45_RS05485 (UXQ45_005485) - 1122649..1122831 (+) 183 WP_000028422.1 hypothetical protein -
  UXQ45_RS05490 (UXQ45_005490) - 1122824..1123366 (+) 543 WP_000185659.1 dUTP pyrophosphatase -
  UXQ45_RS05495 (UXQ45_005495) - 1123403..1123609 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  UXQ45_RS05500 (UXQ45_005500) - 1123606..1123992 (+) 387 WP_000592207.1 hypothetical protein -
  UXQ45_RS05505 (UXQ45_005505) - 1123989..1124162 (+) 174 WP_000595244.1 transcriptional activator RinB -
  UXQ45_RS05510 (UXQ45_005510) - 1124163..1124309 (+) 147 WP_000990001.1 hypothetical protein -
  UXQ45_RS05515 (UXQ45_005515) - 1124333..1124755 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  UXQ45_RS05520 (UXQ45_005520) - 1124942..1125382 (+) 441 WP_001003272.1 terminase small subunit -
  UXQ45_RS05525 (UXQ45_005525) - 1125369..1126646 (+) 1278 WP_064265441.1 PBSX family phage terminase large subunit -
  UXQ45_RS05530 (UXQ45_005530) - 1126657..1128195 (+) 1539 WP_000909977.1 phage portal protein -
  UXQ45_RS05535 (UXQ45_005535) - 1128202..1129197 (+) 996 WP_001133044.1 minor capsid protein -
  UXQ45_RS05540 (UXQ45_005540) - 1129270..1129440 (+) 171 WP_000072208.1 hypothetical protein -
  UXQ45_RS05545 (UXQ45_005545) - 1129468..1129561 (+) 94 Protein_1085 hypothetical protein -
  UXQ45_RS05550 (UXQ45_005550) - 1129549..1130169 (+) 621 WP_000392151.1 DUF4355 domain-containing protein -
  UXQ45_RS05555 (UXQ45_005555) - 1130183..1131157 (+) 975 WP_000438512.1 phage major capsid protein -
  UXQ45_RS05560 (UXQ45_005560) - 1131179..1131466 (+) 288 WP_001114085.1 hypothetical protein -
  UXQ45_RS05565 (UXQ45_005565) - 1131475..1131807 (+) 333 WP_000208960.1 phage head-tail connector protein -
  UXQ45_RS05570 (UXQ45_005570) - 1131804..1132106 (+) 303 WP_095252307.1 hypothetical protein -
  UXQ45_RS05575 (UXQ45_005575) - 1132106..1132453 (+) 348 WP_064277304.1 HK97-gp10 family putative phage morphogenesis protein -
  UXQ45_RS05580 (UXQ45_005580) - 1132465..1132848 (+) 384 WP_000188649.1 hypothetical protein -
  UXQ45_RS05585 (UXQ45_005585) - 1132867..1133448 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  UXQ45_RS05590 (UXQ45_005590) - 1133510..1133875 (+) 366 WP_001100161.1 tail assembly chaperone -
  UXQ45_RS05595 (UXQ45_005595) - 1133905..1134249 (+) 345 WP_000105584.1 hypothetical protein -
  UXQ45_RS05600 (UXQ45_005600) - 1134266..1137730 (+) 3465 WP_196496712.1 hypothetical protein -
  UXQ45_RS05605 (UXQ45_005605) - 1137743..1138690 (+) 948 WP_031794375.1 phage tail family protein -
  UXQ45_RS05610 (UXQ45_005610) - 1138699..1140600 (+) 1902 WP_000152714.1 SGNH/GDSL hydrolase family protein -
  UXQ45_RS05615 (UXQ45_005615) - 1140615..1142525 (+) 1911 WP_064277290.1 hypothetical protein -
  UXQ45_RS05620 (UXQ45_005620) - 1142525..1144348 (+) 1824 WP_064277292.1 phage baseplate upper protein -
  UXQ45_RS05625 (UXQ45_005625) - 1144348..1144725 (+) 378 WP_000705902.1 DUF2977 domain-containing protein -
  UXQ45_RS05630 (UXQ45_005630) - 1144729..1144902 (+) 174 WP_001790193.1 XkdX family protein -
  UXQ45_RS05635 (UXQ45_005635) - 1144943..1145242 (+) 300 WP_000466770.1 DUF2951 domain-containing protein -
  UXQ45_RS05640 (UXQ45_005640) - 1145379..1147277 (+) 1899 WP_000524017.1 glucosaminidase domain-containing protein -
  UXQ45_RS05645 (UXQ45_005645) - 1147290..1148528 (+) 1239 WP_000276641.1 BppU family phage baseplate upper protein -
  UXQ45_RS05650 (UXQ45_005650) - 1148533..1148928 (+) 396 WP_000398862.1 hypothetical protein -
  UXQ45_RS05655 (UXQ45_005655) - 1148984..1149421 (+) 438 WP_000354121.1 phage holin -
  UXQ45_RS05660 (UXQ45_005660) - 1149402..1150847 (+) 1446 WP_095252304.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17654.38 Da        Isoelectric Point: 4.6228

>NTDB_id=1006712 UXQ45_RS05440 WP_029549393.1 1119328..1119798(+) (ssbA) [Staphylococcus aureus strain BSN48-2]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1006712 UXQ45_RS05440 WP_029549393.1 1119328..1119798(+) (ssbA) [Staphylococcus aureus strain BSN48-2]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.017

100

0.692

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment