Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXR76_RS05455 Genome accession   NZ_CP157306
Coordinates   1113771..1114241 (+) Length   156 a.a.
NCBI ID   WP_029549393.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN85     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1103501..1147338 1113771..1114241 within 0


Gene organization within MGE regions


Location: 1103501..1147338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXR76_RS05365 (UXR76_005365) - 1103501..1104886 (-) 1386 WP_000861313.1 recombinase family protein -
  UXR76_RS05370 (UXR76_005370) - 1105093..1105215 (-) 123 WP_001077637.1 hypothetical protein -
  UXR76_RS05375 (UXR76_005375) - 1105236..1105697 (-) 462 WP_000525016.1 hypothetical protein -
  UXR76_RS05380 (UXR76_005380) - 1105710..1106033 (-) 324 WP_001260487.1 helix-turn-helix domain-containing protein -
  UXR76_RS05385 (UXR76_005385) - 1106197..1106445 (+) 249 WP_000272858.1 helix-turn-helix domain-containing protein -
  UXR76_RS05390 (UXR76_005390) - 1106461..1107249 (+) 789 WP_001148566.1 phage antirepressor KilAC domain-containing protein -
  UXR76_RS05395 (UXR76_005395) - 1107265..1107423 (+) 159 WP_000398750.1 hypothetical protein -
  UXR76_RS05400 (UXR76_005400) - 1107398..1107727 (-) 330 WP_000514498.1 hypothetical protein -
  UXR76_RS05405 (UXR76_005405) - 1107784..1108527 (+) 744 WP_001148623.1 phage antirepressor KilAC domain-containing protein -
  UXR76_RS05410 (UXR76_005410) - 1108703..1108933 (-) 231 WP_000395457.1 hypothetical protein -
  UXR76_RS05415 (UXR76_005415) - 1108983..1109120 (+) 138 WP_000230552.1 hypothetical protein -
  UXR76_RS05420 (UXR76_005420) - 1109113..1109283 (+) 171 WP_001837399.1 DUF1270 domain-containing protein -
  UXR76_RS05425 (UXR76_005425) - 1109264..1109602 (+) 339 WP_015990309.1 transcriptional regulator -
  UXR76_RS05430 (UXR76_005430) - 1109666..1109926 (+) 261 WP_001837398.1 DUF1108 family protein -
  UXR76_RS05435 (UXR76_005435) - 1109935..1110198 (+) 264 WP_001205732.1 hypothetical protein -
  UXR76_RS05440 (UXR76_005440) - 1110207..1112150 (+) 1944 WP_031896414.1 AAA family ATPase -
  UXR76_RS05445 (UXR76_005445) - 1112152..1113072 (+) 921 WP_000138475.1 recombinase RecT -
  UXR76_RS05450 (UXR76_005450) - 1113153..1113770 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  UXR76_RS05455 (UXR76_005455) ssbA 1113771..1114241 (+) 471 WP_029549393.1 single-stranded DNA-binding protein Machinery gene
  UXR76_RS05460 (UXR76_005460) - 1114271..1115155 (+) 885 WP_271321815.1 DnaD domain protein -
  UXR76_RS05465 (UXR76_005465) - 1115162..1115380 (+) 219 WP_000338528.1 hypothetical protein -
  UXR76_RS05470 (UXR76_005470) - 1115389..1115793 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  UXR76_RS05475 (UXR76_005475) - 1115806..1116177 (+) 372 WP_001651750.1 SA1788 family PVL leukocidin-associated protein -
  UXR76_RS05480 (UXR76_005480) - 1116177..1116434 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  UXR76_RS05485 (UXR76_005485) - 1116437..1116679 (+) 243 WP_000221877.1 SAV1978 family virulence-associated passenger protein -
  UXR76_RS05490 (UXR76_005490) - 1116691..1116858 (+) 168 WP_001624242.1 hypothetical protein -
  UXR76_RS05495 (UXR76_005495) - 1116851..1117102 (+) 252 WP_001065092.1 DUF1024 family protein -
  UXR76_RS05500 (UXR76_005500) - 1117092..1117274 (+) 183 WP_000028422.1 hypothetical protein -
  UXR76_RS05505 (UXR76_005505) - 1117267..1117809 (+) 543 WP_000185659.1 dUTP diphosphatase -
  UXR76_RS05510 (UXR76_005510) - 1117846..1118052 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  UXR76_RS05515 (UXR76_005515) - 1118049..1118435 (+) 387 WP_000592207.1 hypothetical protein -
  UXR76_RS05520 (UXR76_005520) rinB 1118432..1118605 (+) 174 WP_000595257.1 transcriptional activator RinB -
  UXR76_RS05525 (UXR76_005525) - 1118606..1118752 (+) 147 WP_000990001.1 hypothetical protein -
  UXR76_RS05530 (UXR76_005530) - 1118776..1119198 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  UXR76_RS05535 (UXR76_005535) - 1119385..1119825 (+) 441 WP_001003272.1 terminase small subunit -
  UXR76_RS05540 (UXR76_005540) - 1119812..1121089 (+) 1278 WP_064265441.1 PBSX family phage terminase large subunit -
  UXR76_RS05545 (UXR76_005545) - 1121100..1122638 (+) 1539 WP_000909977.1 phage portal protein -
  UXR76_RS05550 (UXR76_005550) - 1122645..1123640 (+) 996 WP_001133044.1 minor capsid protein -
  UXR76_RS05555 (UXR76_005555) - 1123713..1123883 (+) 171 WP_000072208.1 hypothetical protein -
  UXR76_RS05560 (UXR76_005560) - 1123911..1123998 (+) 88 Protein_1088 hypothetical protein -
  UXR76_RS05565 (UXR76_005565) - 1123992..1124612 (+) 621 WP_064134212.1 DUF4355 domain-containing protein -
  UXR76_RS05570 (UXR76_005570) - 1124626..1125600 (+) 975 WP_000438513.1 phage major capsid protein -
  UXR76_RS05575 (UXR76_005575) - 1125622..1125909 (+) 288 WP_001114085.1 hypothetical protein -
  UXR76_RS05580 (UXR76_005580) - 1125918..1126250 (+) 333 WP_000208960.1 phage head-tail connector protein -
  UXR76_RS05585 (UXR76_005585) - 1126247..1126549 (+) 303 WP_001268312.1 hypothetical protein -
  UXR76_RS05590 (UXR76_005590) - 1126549..1126896 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  UXR76_RS05595 (UXR76_005595) - 1126908..1127291 (+) 384 WP_000188648.1 hypothetical protein -
  UXR76_RS05600 (UXR76_005600) - 1127310..1127891 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  UXR76_RS05605 (UXR76_005605) - 1127953..1128318 (+) 366 WP_001100161.1 tail assembly chaperone -
  UXR76_RS05610 (UXR76_005610) - 1128348..1128692 (+) 345 WP_000105584.1 hypothetical protein -
  UXR76_RS05615 (UXR76_005615) - 1128709..1132173 (+) 3465 WP_064265435.1 hypothetical protein -
  UXR76_RS05620 (UXR76_005620) - 1132186..1133133 (+) 948 WP_031794375.1 phage tail family protein -
  UXR76_RS05625 (UXR76_005625) - 1133142..1135043 (+) 1902 WP_000152714.1 SGNH/GDSL hydrolase family protein -
  UXR76_RS05630 (UXR76_005630) - 1135058..1136968 (+) 1911 WP_209187600.1 hypothetical protein -
  UXR76_RS05635 (UXR76_005635) - 1136968..1138792 (+) 1825 Protein_1103 phage baseplate upper protein -
  UXR76_RS05640 (UXR76_005640) - 1138792..1139169 (+) 378 WP_000705910.1 DUF2977 domain-containing protein -
  UXR76_RS05645 (UXR76_005645) - 1139173..1139346 (+) 174 WP_000782200.1 XkdX family protein -
  UXR76_RS05650 (UXR76_005650) - 1139386..1139685 (+) 300 WP_000466767.1 DUF2951 domain-containing protein -
  UXR76_RS05655 (UXR76_005655) - 1139822..1141720 (+) 1899 WP_031868349.1 glucosaminidase domain-containing protein -
  UXR76_RS05660 (UXR76_005660) - 1141733..1142971 (+) 1239 WP_001665438.1 BppU family phage baseplate upper protein -
  UXR76_RS05665 (UXR76_005665) - 1142977..1143372 (+) 396 WP_001611616.1 hypothetical protein -
  UXR76_RS05670 (UXR76_005670) - 1143428..1143865 (+) 438 WP_000354132.1 phage holin -
  UXR76_RS05675 (UXR76_005675) - 1143846..1145291 (+) 1446 WP_209187598.1 SH3 domain-containing protein -
  UXR76_RS05680 (UXR76_005680) - 1145800..1146594 (+) 795 WP_000238963.1 HipA family kinase -
  UXR76_RS05685 (UXR76_005685) - 1146601..1147338 (+) 738 WP_000278830.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17654.38 Da        Isoelectric Point: 4.6228

>NTDB_id=1005717 UXR76_RS05455 WP_029549393.1 1113771..1114241(+) (ssbA) [Staphylococcus aureus strain BSN85]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1005717 UXR76_RS05455 WP_029549393.1 1113771..1114241(+) (ssbA) [Staphylococcus aureus strain BSN85]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.017

100

0.692

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment