Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABFT67_RS00875 | Genome accession | NZ_CP156744 |
| Coordinates | 178799..179284 (+) | Length | 161 a.a. |
| NCBI ID | WP_005711354.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus strain TCI366 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 169429..208988 | 178799..179284 | within | 0 |
Gene organization within MGE regions
Location: 169429..208988
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFT67_RS00795 (ABFT67_00795) | - | 169429..170613 (-) | 1185 | WP_005714751.1 | tyrosine-type recombinase/integrase | - |
| ABFT67_RS00800 (ABFT67_00800) | - | 170958..171959 (-) | 1002 | WP_005714749.1 | hypothetical protein | - |
| ABFT67_RS00805 (ABFT67_00805) | - | 172073..172663 (-) | 591 | WP_020751902.1 | DUF5067 domain-containing protein | - |
| ABFT67_RS00810 (ABFT67_00810) | - | 172723..173145 (-) | 423 | WP_003594164.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABFT67_RS00815 (ABFT67_00815) | - | 173135..173470 (-) | 336 | WP_005714743.1 | helix-turn-helix transcriptional regulator | - |
| ABFT67_RS00820 (ABFT67_00820) | - | 173608..173850 (+) | 243 | WP_005711333.1 | helix-turn-helix transcriptional regulator | - |
| ABFT67_RS00825 (ABFT67_00825) | - | 173847..174005 (+) | 159 | WP_005711335.1 | hypothetical protein | - |
| ABFT67_RS00830 (ABFT67_00830) | - | 174023..174754 (+) | 732 | WP_005711337.1 | antA/AntB antirepressor family protein | - |
| ABFT67_RS00835 (ABFT67_00835) | - | 174820..175368 (+) | 549 | WP_005714742.1 | hypothetical protein | - |
| ABFT67_RS00840 (ABFT67_00840) | - | 175347..175577 (+) | 231 | WP_005711341.1 | hypothetical protein | - |
| ABFT67_RS00845 (ABFT67_00845) | - | 175581..175709 (+) | 129 | WP_005711343.1 | hypothetical protein | - |
| ABFT67_RS00850 (ABFT67_00850) | - | 175721..175948 (+) | 228 | WP_005711345.1 | hypothetical protein | - |
| ABFT67_RS00855 (ABFT67_00855) | - | 175941..176144 (+) | 204 | WP_005711347.1 | hypothetical protein | - |
| ABFT67_RS00860 (ABFT67_00860) | - | 176155..177030 (+) | 876 | WP_005711348.1 | RecT family recombinase | - |
| ABFT67_RS00865 (ABFT67_00865) | - | 176966..177814 (+) | 849 | WP_286011666.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ABFT67_RS00870 (ABFT67_00870) | - | 177830..178786 (+) | 957 | WP_005711352.1 | DnaD domain protein | - |
| ABFT67_RS00875 (ABFT67_00875) | ssb | 178799..179284 (+) | 486 | WP_005711354.1 | single-stranded DNA-binding protein | Machinery gene |
| ABFT67_RS00880 (ABFT67_00880) | - | 179592..179807 (+) | 216 | WP_005711356.1 | helix-turn-helix transcriptional regulator | - |
| ABFT67_RS00885 (ABFT67_00885) | - | 179804..180253 (+) | 450 | WP_005711359.1 | hypothetical protein | - |
| ABFT67_RS00890 (ABFT67_00890) | - | 180300..180554 (+) | 255 | WP_005711361.1 | hypothetical protein | - |
| ABFT67_RS00895 (ABFT67_00895) | - | 180551..180916 (+) | 366 | WP_005714739.1 | hypothetical protein | - |
| ABFT67_RS00900 (ABFT67_00900) | - | 180929..181393 (+) | 465 | WP_005711364.1 | hypothetical protein | - |
| ABFT67_RS00905 (ABFT67_00905) | - | 181405..181656 (+) | 252 | WP_005711366.1 | hypothetical protein | - |
| ABFT67_RS00910 (ABFT67_00910) | - | 181776..182282 (+) | 507 | WP_005711368.1 | DUF1642 domain-containing protein | - |
| ABFT67_RS00915 (ABFT67_00915) | - | 182272..182622 (+) | 351 | WP_005711370.1 | hypothetical protein | - |
| ABFT67_RS00920 (ABFT67_00920) | - | 182619..182827 (+) | 209 | Protein_180 | hypothetical protein | - |
| ABFT67_RS00925 (ABFT67_00925) | - | 182955..183176 (+) | 222 | WP_005711376.1 | helix-turn-helix domain-containing protein | - |
| ABFT67_RS00930 (ABFT67_00930) | - | 183385..183813 (+) | 429 | WP_005711378.1 | hypothetical protein | - |
| ABFT67_RS00935 (ABFT67_00935) | - | 184146..185006 (+) | 861 | WP_005711380.1 | hypothetical protein | - |
| ABFT67_RS00940 (ABFT67_00940) | - | 185547..186695 (+) | 1149 | WP_005711382.1 | GcrA family cell cycle regulator | - |
| ABFT67_RS00945 (ABFT67_00945) | - | 186688..187011 (+) | 324 | WP_005711383.1 | hypothetical protein | - |
| ABFT67_RS00950 (ABFT67_00950) | - | 187048..187581 (+) | 534 | WP_005711385.1 | terminase small subunit | - |
| ABFT67_RS00955 (ABFT67_00955) | - | 187559..188914 (+) | 1356 | WP_005714737.1 | PBSX family phage terminase large subunit | - |
| ABFT67_RS00960 (ABFT67_00960) | - | 188919..190307 (+) | 1389 | WP_005711389.1 | phage portal protein | - |
| ABFT67_RS00965 (ABFT67_00965) | - | 190328..190522 (+) | 195 | WP_225362476.1 | hypothetical protein | - |
| ABFT67_RS00970 (ABFT67_00970) | - | 190525..192054 (+) | 1530 | WP_347547673.1 | minor capsid protein | - |
| ABFT67_RS00975 (ABFT67_00975) | - | 192203..192859 (+) | 657 | WP_005711393.1 | DUF4355 domain-containing protein | - |
| ABFT67_RS00980 (ABFT67_00980) | - | 192875..194037 (+) | 1163 | Protein_192 | hypothetical protein | - |
| ABFT67_RS00985 (ABFT67_00985) | - | 194116..194490 (+) | 375 | WP_005711397.1 | phage head-tail connector protein | - |
| ABFT67_RS00990 (ABFT67_00990) | - | 194495..194797 (+) | 303 | WP_005711399.1 | hypothetical protein | - |
| ABFT67_RS00995 (ABFT67_00995) | - | 194794..195159 (+) | 366 | WP_005711401.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABFT67_RS01000 (ABFT67_01000) | - | 195160..195564 (+) | 405 | WP_003582636.1 | DUF3168 domain-containing protein | - |
| ABFT67_RS01005 (ABFT67_01005) | - | 195576..196181 (+) | 606 | WP_005711403.1 | phage tail tube protein | - |
| ABFT67_RS01010 (ABFT67_01010) | - | 196268..196600 (+) | 333 | WP_005711405.1 | tail assembly chaperone | - |
| ABFT67_RS01015 (ABFT67_01015) | - | 196705..197058 (+) | 354 | WP_005711407.1 | hypothetical protein | - |
| ABFT67_RS01020 (ABFT67_01020) | - | 197051..200140 (+) | 3090 | WP_005711409.1 | tape measure protein | - |
| ABFT67_RS01025 (ABFT67_01025) | - | 200141..202129 (+) | 1989 | WP_005714730.1 | distal tail protein Dit | - |
| ABFT67_RS01030 (ABFT67_01030) | - | 202130..204565 (+) | 2436 | WP_020751906.1 | phage tail protein | - |
| ABFT67_RS01035 (ABFT67_01035) | - | 204567..204857 (+) | 291 | WP_005713395.1 | hypothetical protein | - |
| ABFT67_RS01040 (ABFT67_01040) | - | 204850..204981 (+) | 132 | WP_005714777.1 | XkdX family protein | - |
| ABFT67_RS01045 (ABFT67_01045) | - | 205011..205301 (+) | 291 | WP_005714776.1 | hypothetical protein | - |
| ABFT67_RS01050 (ABFT67_01050) | - | 205294..205740 (+) | 447 | WP_005714775.1 | phage holin | - |
| ABFT67_RS01055 (ABFT67_01055) | - | 205751..206935 (+) | 1185 | WP_005713391.1 | GH25 family lysozyme | - |
| ABFT67_RS01060 (ABFT67_01060) | - | 207133..207207 (+) | 75 | Protein_208 | glucose-6-phosphate isomerase | - |
| ABFT67_RS01065 (ABFT67_01065) | - | 207555..207842 (-) | 288 | WP_005713389.1 | putative quinol monooxygenase | - |
| ABFT67_RS01070 (ABFT67_01070) | - | 208137..208988 (-) | 852 | WP_005713388.1 | DNA/RNA non-specific endonuclease | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17645.39 Da Isoelectric Point: 7.9701
>NTDB_id=1002406 ABFT67_RS00875 WP_005711354.1 178799..179284(+) (ssb) [Lacticaseibacillus rhamnosus strain TCI366]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQTSQNSPKSQQTVNASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQTSQNSPKSQQTVNASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=1002406 ABFT67_RS00875 WP_005711354.1 178799..179284(+) (ssb) [Lacticaseibacillus rhamnosus strain TCI366]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGTCCTAAATCACAGCAAACAGTCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGTCCTAAATCACAGCAAACAGTCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
62.791 |
100 |
0.671 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
49.419 |
100 |
0.528 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
65.839 |
0.36 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.36 |