Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABFK61_RS06400 | Genome accession | NZ_CP156041 |
| Coordinates | 1361020..1361373 (+) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain D78 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1338201..1363739 | 1361020..1361373 | within | 0 |
Gene organization within MGE regions
Location: 1338201..1363739
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFK61_RS06235 (ABFK61_06235) | - | 1338201..1339199 (-) | 999 | WP_001284079.1 | phage portal protein | - |
| ABFK61_RS06240 (ABFK61_06240) | - | 1339199..1341007 (-) | 1809 | WP_000289874.1 | terminase family protein | - |
| ABFK61_RS06245 (ABFK61_06245) | - | 1341145..1341972 (+) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| ABFK61_RS06250 (ABFK61_06250) | - | 1342025..1343014 (+) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| ABFK61_RS06255 (ABFK61_06255) | gpM | 1343025..1343771 (+) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| ABFK61_RS06260 (ABFK61_06260) | - | 1343875..1344327 (+) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| ABFK61_RS06265 (ABFK61_06265) | - | 1344328..1344537 (+) | 210 | WP_000659474.1 | tail protein X | - |
| ABFK61_RS06270 (ABFK61_06270) | - | 1344546..1344896 (+) | 351 | WP_001114936.1 | putative holin | - |
| ABFK61_RS06275 (ABFK61_06275) | - | 1344893..1345162 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| ABFK61_RS06280 (ABFK61_06280) | - | 1345159..1345989 (+) | 831 | WP_059245620.1 | N-acetylmuramidase family protein | - |
| ABFK61_RS06285 (ABFK61_06285) | - | 1345986..1346513 (+) | 528 | WP_000742888.1 | phage tail protein | - |
| ABFK61_RS06290 (ABFK61_06290) | - | 1346510..1346959 (+) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| ABFK61_RS06295 (ABFK61_06295) | - | 1347032..1347178 (+) | 147 | Protein_1236 | phage baseplate assembly protein V | - |
| ABFK61_RS06300 (ABFK61_06300) | - | 1347178..1347534 (+) | 357 | Protein_1237 | phage major tail tube protein | - |
| ABFK61_RS06305 (ABFK61_06305) | - | 1347601..1347942 (+) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| ABFK61_RS06310 (ABFK61_06310) | - | 1347978..1348082 (+) | 105 | WP_225463614.1 | GpE family phage tail protein | - |
| ABFK61_RS06315 (ABFK61_06315) | - | 1348096..1350546 (+) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| ABFK61_RS06320 (ABFK61_06320) | - | 1350552..1350992 (+) | 441 | WP_000979757.1 | phage tail protein | - |
| ABFK61_RS06325 (ABFK61_06325) | - | 1350993..1352306 (+) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| ABFK61_RS06330 (ABFK61_06330) | - | 1352436..1352675 (+) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| ABFK61_RS06335 (ABFK61_06335) | - | 1352672..1352872 (+) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| ABFK61_RS06340 (ABFK61_06340) | - | 1353188..1353469 (-) | 282 | WP_000713873.1 | hypothetical protein | - |
| ABFK61_RS06345 (ABFK61_06345) | - | 1353469..1354347 (-) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| ABFK61_RS06350 (ABFK61_06350) | - | 1354657..1354851 (+) | 195 | WP_000696053.1 | hypothetical protein | - |
| ABFK61_RS06355 (ABFK61_06355) | - | 1354959..1355774 (+) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| ABFK61_RS06360 (ABFK61_06360) | - | 1355899..1356114 (+) | 216 | WP_000556351.1 | hypothetical protein | - |
| ABFK61_RS06365 (ABFK61_06365) | - | 1356159..1356500 (-) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| ABFK61_RS06370 (ABFK61_06370) | - | 1356593..1356784 (+) | 192 | WP_001043481.1 | hypothetical protein | - |
| ABFK61_RS06375 (ABFK61_06375) | - | 1356878..1359616 (+) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| ABFK61_RS06380 (ABFK61_06380) | - | 1359613..1359945 (+) | 333 | WP_000632296.1 | hypothetical protein | - |
| ABFK61_RS06385 (ABFK61_06385) | - | 1360011..1360562 (+) | 552 | WP_001178668.1 | hypothetical protein | - |
| ABFK61_RS06390 (ABFK61_06390) | - | 1360552..1360722 (+) | 171 | WP_001015076.1 | hypothetical protein | - |
| ABFK61_RS06395 (ABFK61_06395) | - | 1360715..1361032 (+) | 318 | WP_000049658.1 | hypothetical protein | - |
| ABFK61_RS06400 (ABFK61_06400) | ssb | 1361020..1361373 (+) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| ABFK61_RS06405 (ABFK61_06405) | - | 1361383..1362120 (+) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| ABFK61_RS06410 (ABFK61_06410) | - | 1362130..1362351 (+) | 222 | WP_000424605.1 | hypothetical protein | - |
| ABFK61_RS06415 (ABFK61_06415) | - | 1362348..1362644 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| ABFK61_RS06420 (ABFK61_06420) | - | 1362672..1363739 (-) | 1068 | WP_000107854.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=1001476 ABFK61_RS06400 WP_002014678.1 1361020..1361373(+) (ssb) [Acinetobacter baumannii strain D78]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=1001476 ABFK61_RS06400 WP_002014678.1 1361020..1361373(+) (ssb) [Acinetobacter baumannii strain D78]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |