Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-DinJ
Location 522682..523167 Replicon chromosome
Accession NZ_LR134331
Organism Lacticaseibacillus rhamnosus strain NCTC13764

Toxin (Protein)


Gene name yafQ Uniprot ID C2K0Y1
Locus tag EL173_RS02595 Protein ID WP_005691636.1
Coordinates 522682..522867 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A508YYT1
Locus tag EL173_RS02600 Protein ID WP_014571130.1
Coordinates 522895..523167 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL173_RS02570 517689..518378 + 690 WP_005691628.1 rhomboid family intramembrane serine protease -
EL173_RS02575 518870..519478 - 609 WP_005691630.1 hypothetical protein -
EL173_RS02585 519925..520800 + 876 WP_025014074.1 Rgg/GadR/MutR family transcriptional regulator -
EL173_RS02590 521043..522458 - 1416 WP_005691634.1 DNA polymerase III subunit epsilon -
EL173_RS02595 522682..522867 - 186 WP_005691636.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
EL173_RS02600 522895..523167 - 273 WP_014571130.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL173_RS02605 523729..523977 + 249 WP_005691639.1 hypothetical protein -
EL173_RS02610 524220..524513 + 294 WP_005684269.1 metalloregulator ArsR/SmtB family transcription factor -
EL173_RS02615 524595..525758 + 1164 WP_005691640.1 MFS transporter -
EL173_RS02620 525912..526487 + 576 WP_014571131.1 DNA-3-methyladenine glycosylase I -
EL173_RS02625 526630..527226 + 597 WP_005691643.1 IS607 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 518870..528892 10022


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-57)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-65)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6781.86 Da        Isoelectric Point: 7.4698

>T287704 WP_005691636.1 NZ_LR134331:c522867-522682 [Lacticaseibacillus rhamnosus]
MQRQGHVKLASLHDHALKGAHSGERALRVAPDWLLVYKVDAEALILMLLATGTHRDTLNIE

Download         Length: 186 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10005.62 Da        Isoelectric Point: 9.5939

>AT287704 WP_014571130.1 NZ_LR134331:c523167-522895 [Lacticaseibacillus rhamnosus]
MTKKSRISVRIDTKTKERALHVLNSMGLDISSAINMYLKRIGDTGALPFTPPMSFVDQLQVAEADVKAGRIKSFKTVDAL
MKDLYSDVDD

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X2J6C9

Antitoxin

Source ID Structure
AlphaFold DB A0A508YYT1

References