Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 1035923..1036294 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | QSI84_RS05175 | Protein ID | WP_001317028.1 |
Coordinates | 1036100..1036294 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 1035923..1036101 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS05145 (1031675) | 1031675..1031848 | + | 174 | WP_001296046.1 | protein YnaL | - |
QSI84_RS05150 (1031878) | 1031878..1033251 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
QSI84_RS05155 (1033380) | 1033380..1034315 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
QSI84_RS05160 (1034367) | 1034367..1035602 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
QSI84_RS05165 (1035604) | 1035604..1035819 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (1035923) | 1035923..1036101 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1035923) | 1035923..1036101 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1035923) | 1035923..1036101 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1035923) | 1035923..1036101 | + | 179 | NuclAT_0 | - | Antitoxin |
QSI84_RS05170 (1035898) | 1035898..1036107 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
QSI84_RS05175 (1036100) | 1036100..1036294 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
QSI84_RS05180 (1036351) | 1036351..1037160 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
QSI84_RS05185 (1037153) | 1037153..1039753 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
QSI84_RS05190 (1039855) | 1039855..1040130 | - | 276 | WP_000632297.1 | protein RacC | - |
QSI84_RS05195 (1040205) | 1040205..1040375 | - | 171 | WP_001352098.1 | YdaE family protein | - |
QSI84_RS05200 (1040375) | 1040375..1040596 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1034367..1056041 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T284412 WP_001317028.1 NZ_CP128218:c1036294-1036100 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT284412 NZ_CP128218:1035923-1036101 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|