Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1105991..1106658 | Replicon | chromosome |
Accession | NZ_CP117010 | ||
Organism | Escherichia coli strain MLI110 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | NL413_RS06025 | Protein ID | WP_001094400.1 |
Coordinates | 1105991..1106320 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | NL413_RS06030 | Protein ID | WP_000072690.1 |
Coordinates | 1106341..1106658 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL413_RS06020 (1101909) | 1101909..1105631 | + | 3723 | Protein_1045 | adhesin-like autotransporter YpjA/EhaD | - |
NL413_RS06025 (1105991) | 1105991..1106320 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
NL413_RS06030 (1106341) | 1106341..1106658 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL413_RS06035 (1106696) | 1106696..1106896 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
NL413_RS06040 (1106905) | 1106905..1107387 | - | 483 | WP_001407480.1 | RadC family protein | - |
NL413_RS06045 (1107396) | 1107396..1107854 | - | 459 | WP_000211841.1 | antirestriction protein | - |
NL413_RS06050 (1107957) | 1107957..1108141 | - | 185 | Protein_1051 | DUF905 family protein | - |
NL413_RS06055 (1108752) | 1108752..1110455 | - | 1704 | WP_000896263.1 | protein YfjW | - |
NL413_RS06060 (1110597) | 1110597..1111606 | + | 1010 | Protein_1053 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1095150..1130681 | 35531 | ||
flank | IS/Tn | - | - | 1100798..1101778 | 980 | ||
- | inside | Prophage | - | luxS | 1051699..1130076 | 78377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T269792 WP_001094400.1 NZ_CP117010:c1106320-1105991 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |