Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 868867..869238 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | O6117_RS04315 | Protein ID | WP_001317028.1 |
Coordinates | 869044..869238 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 868867..869045 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS04285 (864619) | 864619..864792 | + | 174 | WP_001296046.1 | protein YnaL | - |
O6117_RS04290 (864822) | 864822..866195 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
O6117_RS04295 (866324) | 866324..867259 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
O6117_RS04300 (867311) | 867311..868546 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
O6117_RS04305 (868548) | 868548..868763 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (868867) | 868867..869045 | + | 179 | NuclAT_0 | - | Antitoxin |
- (868867) | 868867..869045 | + | 179 | NuclAT_0 | - | Antitoxin |
- (868867) | 868867..869045 | + | 179 | NuclAT_0 | - | Antitoxin |
- (868867) | 868867..869045 | + | 179 | NuclAT_0 | - | Antitoxin |
O6117_RS04310 (868842) | 868842..869051 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
O6117_RS04315 (869044) | 869044..869238 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
O6117_RS04320 (869295) | 869295..870104 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
O6117_RS04325 (870097) | 870097..872697 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
O6117_RS04330 (872799) | 872799..873074 | - | 276 | WP_000632297.1 | protein RacC | - |
O6117_RS04335 (873149) | 873149..873319 | - | 171 | WP_001352098.1 | YdaE family protein | - |
O6117_RS04340 (873319) | 873319..873540 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 867311..888985 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T267016 WP_001317028.1 NZ_CP114896:c869238-869044 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT267016 NZ_CP114896:868867-869045 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|