Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2053637..2054008 | Replicon | chromosome |
Accession | NZ_CP114895 | ||
Organism | Escherichia coli strain CM56 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | O6106_RS10140 | Protein ID | WP_001317028.1 |
Coordinates | 2053814..2054008 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2053637..2053815 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6106_RS10110 (2049389) | 2049389..2049562 | + | 174 | WP_001296046.1 | protein YnaL | - |
O6106_RS10115 (2049592) | 2049592..2050965 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
O6106_RS10120 (2051094) | 2051094..2052029 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
O6106_RS10125 (2052081) | 2052081..2053316 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
O6106_RS10130 (2053318) | 2053318..2053533 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2053637) | 2053637..2053815 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2053637) | 2053637..2053815 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2053637) | 2053637..2053815 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2053637) | 2053637..2053815 | + | 179 | NuclAT_0 | - | Antitoxin |
O6106_RS10135 (2053612) | 2053612..2053821 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
O6106_RS10140 (2053814) | 2053814..2054008 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
O6106_RS10145 (2054065) | 2054065..2054874 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
O6106_RS10150 (2054867) | 2054867..2057467 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
O6106_RS10155 (2057569) | 2057569..2057844 | - | 276 | WP_000632297.1 | protein RacC | - |
O6106_RS10160 (2057919) | 2057919..2058089 | - | 171 | WP_001352098.1 | YdaE family protein | - |
O6106_RS10165 (2058089) | 2058089..2058310 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2052081..2073755 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T266997 WP_001317028.1 NZ_CP114895:c2054008-2053814 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT266997 NZ_CP114895:2053637-2053815 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|