Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 764866..765237 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | O6X69_RS03840 | Protein ID | WP_001317028.1 |
Coordinates | 765043..765237 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 764866..765044 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS03810 (760618) | 760618..760791 | + | 174 | WP_001296046.1 | protein YnaL | - |
O6X69_RS03815 (760821) | 760821..762194 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
O6X69_RS03820 (762323) | 762323..763258 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
O6X69_RS03825 (763310) | 763310..764545 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
O6X69_RS03830 (764547) | 764547..764762 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (764866) | 764866..765044 | + | 179 | NuclAT_0 | - | Antitoxin |
- (764866) | 764866..765044 | + | 179 | NuclAT_0 | - | Antitoxin |
- (764866) | 764866..765044 | + | 179 | NuclAT_0 | - | Antitoxin |
- (764866) | 764866..765044 | + | 179 | NuclAT_0 | - | Antitoxin |
O6X69_RS03835 (764841) | 764841..765050 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
O6X69_RS03840 (765043) | 765043..765237 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
O6X69_RS03845 (765294) | 765294..766103 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
O6X69_RS03850 (766096) | 766096..768696 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
O6X69_RS03855 (768798) | 768798..769073 | - | 276 | WP_000632297.1 | protein RacC | - |
O6X69_RS03860 (769148) | 769148..769318 | - | 171 | WP_001352098.1 | YdaE family protein | - |
O6X69_RS03865 (769318) | 769318..769539 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 756051..784984 | 28933 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T266964 WP_001317028.1 NZ_CP114894:c765237-765043 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT266964 NZ_CP114894:764866-765044 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|