Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 1500976..1501347 | Replicon | chromosome |
| Accession | NZ_CP110018 | ||
| Organism | Escherichia coli strain DH10B | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | OLR78_RS07475 | Protein ID | WP_001317028.1 |
| Coordinates | 1501153..1501347 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 1500976..1501154 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR78_RS07445 (1496728) | 1496728..1496901 | + | 174 | WP_001296046.1 | protein YnaL | - |
| OLR78_RS07450 (1496931) | 1496931..1498304 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| OLR78_RS07455 (1498433) | 1498433..1499368 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| OLR78_RS07460 (1499420) | 1499420..1500655 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| OLR78_RS07465 (1500657) | 1500657..1500872 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (1500976) | 1500976..1501154 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1500976) | 1500976..1501154 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1500976) | 1500976..1501154 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1500976) | 1500976..1501154 | + | 179 | NuclAT_0 | - | Antitoxin |
| OLR78_RS07470 (1500951) | 1500951..1501160 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| OLR78_RS07475 (1501153) | 1501153..1501347 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| OLR78_RS07480 (1501404) | 1501404..1502213 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| OLR78_RS07485 (1502206) | 1502206..1504806 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
| OLR78_RS07490 (1504908) | 1504908..1505183 | - | 276 | WP_000632297.1 | protein RacC | - |
| OLR78_RS07495 (1505258) | 1505258..1505428 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| OLR78_RS07500 (1505428) | 1505428..1505649 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1499420..1521094 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T262740 WP_001317028.1 NZ_CP110018:c1501347-1501153 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT262740 NZ_CP110018:1500976-1501154 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|