Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 1500968..1501339 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | OLR76_RS07475 | Protein ID | WP_001317028.1 |
Coordinates | 1501145..1501339 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 1500968..1501146 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS07445 (1496720) | 1496720..1496893 | + | 174 | WP_001296046.1 | protein YnaL | - |
OLR76_RS07450 (1496923) | 1496923..1498296 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
OLR76_RS07455 (1498425) | 1498425..1499360 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
OLR76_RS07460 (1499412) | 1499412..1500647 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
OLR76_RS07465 (1500649) | 1500649..1500864 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (1500968) | 1500968..1501146 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1500968) | 1500968..1501146 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1500968) | 1500968..1501146 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1500968) | 1500968..1501146 | + | 179 | NuclAT_0 | - | Antitoxin |
OLR76_RS07470 (1500943) | 1500943..1501152 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
OLR76_RS07475 (1501145) | 1501145..1501339 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
OLR76_RS07480 (1501396) | 1501396..1502205 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
OLR76_RS07485 (1502198) | 1502198..1504798 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
OLR76_RS07490 (1504900) | 1504900..1505175 | - | 276 | WP_000632297.1 | protein RacC | - |
OLR76_RS07495 (1505250) | 1505250..1505420 | - | 171 | WP_001352098.1 | YdaE family protein | - |
OLR76_RS07500 (1505420) | 1505420..1505641 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1499412..1521086 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T262714 WP_001317028.1 NZ_CP110017:c1501339-1501145 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT262714 NZ_CP110017:1500968-1501146 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|