Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3298768..3299448 Replicon chromosome
Accession NZ_CP104025
Organism Erwinia amylovora strain Ea915

Toxin (Protein)


Gene name yeeV Uniprot ID D4HV69
Locus tag MTP51_RS14965 Protein ID WP_004155189.1
Coordinates 3298768..3299088 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID D4HV68
Locus tag MTP51_RS14970 Protein ID WP_004155188.1
Coordinates 3299125..3299448 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTP51_RS14945 (MTP51_14945) 3296579..3296779 - 201 Protein_2878 transposase -
MTP51_RS14950 (MTP51_14950) 3297198..3297473 - 276 WP_004155192.1 type II toxin-antitoxin system RelE/ParE family toxin -
MTP51_RS14955 (MTP51_14955) 3297477..3297725 - 249 WP_004155191.1 ribbon-helix-helix domain-containing protein -
MTP51_RS14960 (MTP51_14960) 3297822..3298655 - 834 WP_004155190.1 DUF4942 domain-containing protein -
MTP51_RS14965 (MTP51_14965) 3298768..3299088 - 321 WP_004155189.1 TA system toxin CbtA family protein Toxin
MTP51_RS14970 (MTP51_14970) 3299125..3299448 - 324 WP_004155188.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
MTP51_RS14975 (MTP51_14975) 3299461..3299931 - 471 WP_004155187.1 DNA repair protein RadC -
MTP51_RS14980 (MTP51_14980) 3300002..3300576 - 575 Protein_2885 DUF945 domain-containing protein -
MTP51_RS14985 (MTP51_14985) 3300801..3301043 - 243 WP_004155184.1 hypothetical protein -
MTP51_RS14990 (MTP51_14990) 3302253..3302450 + 198 WP_004155182.1 AlpA family phage regulatory protein -
MTP51_RS14995 (MTP51_14995) 3302558..3302908 + 351 WP_004155181.1 hypothetical protein -
MTP51_RS15000 (MTP51_15000) 3303352..3304437 + 1086 WP_004155179.1 DNA sulfur modification protein DndB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 3297198..3320356 23158
flank IS/Tn - - 3296555..3296779 224
inside Genomic island - - 3297477..3320356 22879


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(5-105)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12023.69 Da        Isoelectric Point: 5.4732

>T257041 WP_004155189.1 NZ_CP104025:c3299088-3298768 [Erwinia amylovora]
MHISTVPATVPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIEEHIDAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLAATDILRARRATGLINI

Download         Length: 321 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12088.81 Da        Isoelectric Point: 6.4689

>AT257041 WP_004155188.1 NZ_CP104025:c3299448-3299125 [Erwinia amylovora]
MSITLPHEWGLQSDITPRFGARLVQEGNRLYYLADRAGLTVSFSPIHLQKLDQAFPLFVEQLENMLRAGELNPHQQHQVT
IQLTSLTCIADTRGSCGYVYISIYPTP

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A831EPU6

Antitoxin

Source ID Structure
AlphaFold DB A0A831ENV6

References