Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 1285996..1286367 | Replicon | chromosome |
Accession | NZ_CP102380 | ||
Organism | Escherichia coli strain BM28 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | NR349_RS06270 | Protein ID | WP_001317028.1 |
Coordinates | 1286173..1286367 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 1285996..1286174 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR349_RS06245 (1281951) | 1281951..1283324 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
NR349_RS06250 (1283453) | 1283453..1284388 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NR349_RS06255 (1284440) | 1284440..1285675 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
NR349_RS06260 (1285677) | 1285677..1285892 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (1285996) | 1285996..1286174 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1285996) | 1285996..1286174 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1285996) | 1285996..1286174 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1285996) | 1285996..1286174 | + | 179 | NuclAT_0 | - | Antitoxin |
NR349_RS06265 (1285971) | 1285971..1286180 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
NR349_RS06270 (1286173) | 1286173..1286367 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NR349_RS06275 (1286424) | 1286424..1287233 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
NR349_RS06280 (1287226) | 1287226..1289825 | - | 2600 | Protein_1220 | exodeoxyribonuclease VIII | - |
NR349_RS06285 (1289927) | 1289927..1290202 | - | 276 | WP_000632297.1 | protein RacC | - |
NR349_RS06290 (1290277) | 1290277..1290447 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NR349_RS06295 (1290447) | 1290447..1290668 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1284440..1306114 | 21674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T253570 WP_001317028.1 NZ_CP102380:c1286367-1286173 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT253570 NZ_CP102380:1285996-1286174 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|