Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 1424192..1424563 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | NR351_RS07050 | Protein ID | WP_001317028.1 |
Coordinates | 1424369..1424563 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 1424192..1424370 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS07025 (1420147) | 1420147..1421520 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
NR351_RS07030 (1421649) | 1421649..1422584 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NR351_RS07035 (1422636) | 1422636..1423871 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
NR351_RS07040 (1423873) | 1423873..1424088 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (1424192) | 1424192..1424370 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1424192) | 1424192..1424370 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1424192) | 1424192..1424370 | + | 179 | NuclAT_0 | - | Antitoxin |
- (1424192) | 1424192..1424370 | + | 179 | NuclAT_0 | - | Antitoxin |
NR351_RS07045 (1424167) | 1424167..1424376 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
NR351_RS07050 (1424369) | 1424369..1424563 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NR351_RS07055 (1424620) | 1424620..1425429 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
NR351_RS07060 (1425422) | 1425422..1428022 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
NR351_RS07065 (1428124) | 1428124..1428399 | - | 276 | WP_000632297.1 | protein RacC | - |
NR351_RS07070 (1428474) | 1428474..1428644 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NR351_RS07075 (1428644) | 1428644..1428865 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1415377..1444310 | 28933 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T253501 WP_001317028.1 NZ_CP102378:c1424563-1424369 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT253501 NZ_CP102378:1424192-1424370 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|