Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 34546..34800 Replicon plasmid unnamed
Accession NZ_CP099589
Organism Escherichia coli strain EMG2

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NHF38_RS22870 Protein ID WP_001312851.1
Coordinates 34546..34695 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 34739..34800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF38_RS22850 (30655) 30655..31206 + 552 WP_001235704.1 recombinase family protein -
NHF38_RS22855 (31222) 31222..33318 + 2097 WP_000422420.1 hypothetical protein -
NHF38_RS22860 (33697) 33697..33771 - 75 WP_001442103.1 RepA leader peptide Tap -
NHF38_RS22865 (34005) 34005..34262 - 258 WP_000083834.1 replication regulatory protein RepA -
NHF38_RS22870 (34546) 34546..34695 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (34739) 34739..34800 + 62 NuclAT_1 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_1 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_1 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_1 - Antitoxin
NHF38_RS22875 (35096) 35096..35407 + 312 WP_000802277.1 hypothetical protein -
NHF38_RS22880 (35588) 35588..35674 - 87 Protein_26 endonuclease -
NHF38_RS22885 (35872) 35872..36060 - 189 WP_001345829.1 hypothetical protein -
NHF38_RS22890 (36195) 36195..36362 - 168 Protein_28 ProQ/FINO family protein -
NHF38_RS22900 (37624) 37624..38016 - 393 Protein_30 fertility inhibition protein FinO -
NHF38_RS22905 (38071) 38071..38817 - 747 WP_000205776.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid - - 1..99158 99158


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T249157 WP_001312851.1 NZ_CP099589:c34695-34546 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT249157 NZ_CP099589:34739-34800 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References