Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-DinJ
Location 521490..521975 Replicon chromosome
Accession NZ_CP099396
Organism Lacticaseibacillus rhamnosus strain P118

Toxin (Protein)


Gene name yafQ Uniprot ID C2K0Y1
Locus tag NFI97_RS02460 Protein ID WP_005691636.1
Coordinates 521490..521675 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A508YYT1
Locus tag NFI97_RS02465 Protein ID WP_014571130.1
Coordinates 521703..521975 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFI97_RS02440 516497..517186 + 690 WP_005691628.1 rhomboid family intramembrane serine protease -
NFI97_RS02445 517678..518286 - 609 WP_005691630.1 hypothetical protein -
NFI97_RS02450 518733..519608 + 876 WP_025014074.1 Rgg/GadR/MutR family transcriptional regulator -
NFI97_RS02455 519851..521266 - 1416 WP_005691634.1 exonuclease domain-containing protein -
NFI97_RS02460 521490..521675 - 186 WP_005691636.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NFI97_RS02465 521703..521975 - 273 WP_014571130.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NFI97_RS02470 522537..522785 + 249 WP_005691639.1 hypothetical protein -
NFI97_RS02475 523028..523321 + 294 WP_005684269.1 metalloregulator ArsR/SmtB family transcription factor -
NFI97_RS02480 523403..524566 + 1164 WP_005691640.1 MFS transporter -
NFI97_RS02485 524720..525295 + 576 WP_014571131.1 DNA-3-methyladenine glycosylase I -
NFI97_RS02490 525438..526034 + 597 WP_005691643.1 IS607 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 517678..527700 10022


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-57)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-65)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6781.86 Da        Isoelectric Point: 7.4698

>T248870 WP_005691636.1 NZ_CP099396:c521675-521490 [Lacticaseibacillus rhamnosus]
MQRQGHVKLASLHDHALKGAHSGERALRVAPDWLLVYKVDAEALILMLLATGTHRDTLNIE

Download         Length: 186 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10005.62 Da        Isoelectric Point: 9.5939

>AT248870 WP_014571130.1 NZ_CP099396:c521975-521703 [Lacticaseibacillus rhamnosus]
MTKKSRISVRIDTKTKERALHVLNSMGLDISSAINMYLKRIGDTGALPFTPPMSFVDQLQVAEADVKAGRIKSFKTVDAL
MKDLYSDVDD

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X2J6C9

Antitoxin

Source ID Structure
AlphaFold DB A0A508YYT1

References