Detailed information of TA system TA020122

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): vapBC/VapC-MazE
• Location: 473953..474432
• Replicon: chromosome
• Accession: NC_000911
• Organism: Synechocystis sp. PCC 6803

Toxin (Protein)

• Gene name: vapC
• Uniprot ID: -
• Locus tag: SGL_RS04125
• Protein ID: WP_010871640.1
• Coordinates: 473953..474204 (-)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: vapB
• Uniprot ID: -
• Locus tag: SGL_RS04130
• Protein ID: WP_010871641.1
• Coordinates: 474205..474432 (-)
• Length: 76 a.a.

Genomic Context

Location: 469592..470914 (1323 bp)
Type: Others
Protein ID: WP_010871637.1

Location: 471080..472930 (1851 bp)
Type: Others
Protein ID: WP_010871638.1

Location: 473088..473675 (588 bp)
Type: Others
Protein ID: Protein_446

Location: 469001..469546 (546 bp)
Type: Others
Protein ID: WP_010871636.1

Location: 473953..474204 (252 bp)
Type: Toxin
Protein ID: WP_010871640.1

Location: 474205..474432 (228 bp)
Type: Antitoxin
Protein ID: WP_010871641.1

Location: 474511..474792 (282 bp)
Type: Others
Protein ID: WP_020861443.1

Location: 474789..475007 (219 bp)
Type: Others
Protein ID: WP_010871642.1

Location: 475110..475445 (336 bp)
Type: Others
Protein ID: WP_010871643.1

Location: 475435..475743 (309 bp)
Type: Others
Protein ID: WP_010871644.1

Location: 475873..477399 (1527 bp)
Type: Others
Protein ID: WP_010871645.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
SGL_RS04105 (sll1507)	469001..469546	-	546	WP_010871636.1	alpha/beta hydrolase	-
SGL_RS04110 (slr1603)	469592..470914	+	1323	WP_010871637.1	hypothetical protein	-
SGL_RS04115 (slr1604)	471080..472930	+	1851	WP_010871638.1	ATP-dependent zinc metalloprotease FtsH3	-
SGL_RS04120	473088..473675	+	588	Protein_446	IS5 family transposase	-
SGL_RS04125 (ssl2923)	473953..474204	-	252	WP_010871640.1	type II toxin-antitoxin system VapC family toxin	Toxin
SGL_RS04130 (ssl2922)	474205..474432	-	228	WP_010871641.1	virulence factor	Antitoxin
SGL_RS04135	474511..474792	-	282	WP_020861443.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	-
SGL_RS04140 (ssl2920)	474789..475007	-	219	WP_010871642.1	hypothetical protein	-
SGL_RS04145 (sll1505)	475110..475445	-	336	WP_010871643.1	DUF86 domain-containing protein	-
SGL_RS04150 (sll1504)	475435..475743	-	309	WP_010871644.1	nucleotidyltransferase family protein	-
SGL_RS04155 (sll1503)	475873..477399	-	1527	WP_010871645.1	RNA-directed DNA polymerase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_017038 Synechocystis sp. PCC 6803 substr. GT-I IS/Tn TA026176 473516..473764 0 View NC_017039 Synechocystis sp. PCC 6803 substr. PCC-P IS/Tn TA026184 473516..473764 0 View NC_017052 Synechocystis sp. PCC 6803 substr. PCC-N IS/Tn TA026219 473504..473752 0 View NC_017277 Synechocystis sp. PCC 6803 IS/Tn TA026421 473414..473662 0 View NC_020286 Synechocystis sp. PCC 6803 IS/Tn TA028957 473516..473764 0 View NZ_CP012832 Synechocystis sp. PCC 6803 substr. GT-G IS/Tn TA057266 473516..473764 0 View NZ_CP073017 Synechocystis sp. PCC 6803 IS/Tn TA199519 473515..473763 0 View NZ_CP094998 Synechocystis sp. PCC 6803 substr. GT-T IS/Tn TA240914 473414..473662 0	flank	IS/Tn	-	-	473414..473662	248

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• PIN domain (3-80)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9540.13 Da
• Isoelectric Point: 7.9952

>T20122 WP_010871640.1 NC_000911:c474204-473953 [Synechocystis sp. PCC 6803]
MKYLLDTNICIYLIKKKPFKVLAKFQTLEISDIGISSITVAELEYGVSKSQQQSKNRDALMQFLMPLEIVEFNSGSGDRL
WQH

Nucleotide

• Length: 252 bp

>T20122 NC_000911:c474204-473953 [Synechocystis sp. PCC 6803]
ATGAAGTATTTACTAGATACGAATATTTGCATTTATCTCATTAAGAAGAAACCGTTTAAAGTCTTGGCAAAATTTCAAAC
CCTGGAGATATCAGACATTGGTATTTCATCCATTACCGTGGCGGAATTAGAATATGGTGTCAGTAAAAGTCAACAACAAT
CGAAAAATCGTGATGCCTTAATGCAATTCTTGATGCCGCTAGAAATCGTGGAATTTAATTCAGGAAGCGGCGATCGCCTA
TGGCAACATTAG

Antitoxin

Protein

• Length: 76 a.a.
• Molecular weight: 8538.69 Da
• Isoelectric Point: 4.2840

>AT20122 WP_010871641.1 NC_000911:c474432-474205 [Synechocystis sp. PCC 6803]
MNTAQISTDGTHQIVILPENFTIAGSEVYIKKIGSTIILIAKNNPWQSLIESLDQFSDDFMKTREQPPLDIREEF

Nucleotide

• Length: 228 bp

>AT20122 NC_000911:c474432-474205 [Synechocystis sp. PCC 6803]
ATGAACACAGCTCAAATTAGCACCGATGGCACCCATCAAATCGTTATTTTACCAGAAAACTTTACGATAGCCGGAAGCGA
AGTTTACATTAAAAAAATTGGAAGTACAATTATTTTGATTGCTAAAAATAACCCTTGGCAATCCTTAATTGAAAGCTTAG
ATCAATTTTCAGATGATTTTATGAAAACTAGGGAACAGCCTCCCTTAGATATACGAGAAGAGTTCTAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

Source	ID	Structure
No matching records found

Antitoxin

Loading, please wait

Source	ID	Structure
No matching records found