Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAH687_RS08810 Genome accession   NZ_CP155530
Coordinates   1771269..1771409 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain TN5S8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1766269..1776409
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAH687_RS08785 (AAH687_08785) - 1766500..1766907 (+) 408 WP_007500468.1 YueI family protein -
  AAH687_RS08790 (AAH687_08790) - 1766968..1767519 (+) 552 WP_008345872.1 isochorismatase family cysteine hydrolase -
  AAH687_RS08795 (AAH687_08795) - 1767537..1769006 (+) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  AAH687_RS08800 (AAH687_08800) - 1769147..1770373 (+) 1227 WP_046526550.1 HDOD domain-containing protein -
  AAH687_RS08805 (AAH687_08805) - 1770410..1770763 (-) 354 WP_017358939.1 hypothetical protein -
  AAH687_RS08810 (AAH687_08810) degQ 1771269..1771409 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAH687_RS08815 (AAH687_08815) - 1771561..1772484 (+) 924 WP_035389264.1 polyprenyl synthetase family protein -
  AAH687_RS08820 (AAH687_08820) comX 1772462..1772632 (+) 171 WP_017358941.1 competence pheromone ComX -
  AAH687_RS08825 (AAH687_08825) comP 1772646..1774952 (+) 2307 WP_035389261.1 ATP-binding protein Regulator
  AAH687_RS08830 (AAH687_08830) comA 1775033..1775674 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  AAH687_RS08835 (AAH687_08835) - 1775698..1776087 (+) 390 WP_008345855.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=996948 AAH687_RS08810 WP_003213123.1 1771269..1771409(+) (degQ) [Bacillus altitudinis strain TN5S8]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=996948 AAH687_RS08810 WP_003213123.1 1771269..1771409(+) (degQ) [Bacillus altitudinis strain TN5S8]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment