Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AAHT64_RS08130 Genome accession   NZ_CP155054
Coordinates   1551477..1551851 (+) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis strain R38     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1546477..1556851
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT64_RS08090 (AAHT64_08090) corA 1546556..1547509 (+) 954 WP_032677123.1 magnesium transporter CorA -
  AAHT64_RS08095 (AAHT64_08095) - 1547575..1547700 (+) 126 WP_003230155.1 hypothetical protein -
  AAHT64_RS08100 (AAHT64_08100) comGA 1547911..1548981 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AAHT64_RS08105 (AAHT64_08105) comGB 1548968..1550005 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  AAHT64_RS08110 (AAHT64_08110) comGC 1550019..1550315 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAHT64_RS08115 (AAHT64_08115) comGD 1550305..1550736 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AAHT64_RS08120 (AAHT64_08120) comGE 1550720..1551067 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AAHT64_RS08125 (AAHT64_08125) comGF 1551093..1551476 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AAHT64_RS08130 (AAHT64_08130) comGG 1551477..1551851 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AAHT64_RS08135 (AAHT64_08135) spoIIT 1551922..1552101 (+) 180 WP_003230176.1 YqzE family protein -
  AAHT64_RS08140 (AAHT64_08140) yqzG 1552143..1552469 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAHT64_RS08145 (AAHT64_08145) tapA 1552741..1553502 (+) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  AAHT64_RS08150 (AAHT64_08150) sipW 1553486..1554058 (+) 573 WP_003230181.1 signal peptidase I -
  AAHT64_RS08155 (AAHT64_08155) tasA 1554122..1554907 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  AAHT64_RS08160 (AAHT64_08160) sinR 1555000..1555335 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAHT64_RS08165 (AAHT64_08165) sinI 1555369..1555542 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAHT64_RS08170 (AAHT64_08170) yqhG 1555725..1556519 (-) 795 WP_003230200.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=995847 AAHT64_RS08130 WP_003230170.1 1551477..1551851(+) (comGG) [Bacillus subtilis subsp. subtilis strain R38]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=995847 AAHT64_RS08130 WP_003230170.1 1551477..1551851(+) (comGG) [Bacillus subtilis subsp. subtilis strain R38]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment