Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAHT64_RS08165 | Genome accession | NZ_CP155054 |
| Coordinates | 1555369..1555542 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain R38 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1550369..1560542
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAHT64_RS08120 (AAHT64_08120) | comGE | 1550720..1551067 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| AAHT64_RS08125 (AAHT64_08125) | comGF | 1551093..1551476 (+) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| AAHT64_RS08130 (AAHT64_08130) | comGG | 1551477..1551851 (+) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| AAHT64_RS08135 (AAHT64_08135) | spoIIT | 1551922..1552101 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| AAHT64_RS08140 (AAHT64_08140) | yqzG | 1552143..1552469 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AAHT64_RS08145 (AAHT64_08145) | tapA | 1552741..1553502 (+) | 762 | WP_003230180.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAHT64_RS08150 (AAHT64_08150) | sipW | 1553486..1554058 (+) | 573 | WP_003230181.1 | signal peptidase I | - |
| AAHT64_RS08155 (AAHT64_08155) | tasA | 1554122..1554907 (+) | 786 | WP_003230183.1 | biofilm matrix protein TasA | - |
| AAHT64_RS08160 (AAHT64_08160) | sinR | 1555000..1555335 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AAHT64_RS08165 (AAHT64_08165) | sinI | 1555369..1555542 (-) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| AAHT64_RS08170 (AAHT64_08170) | yqhG | 1555725..1556519 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| AAHT64_RS08175 (AAHT64_08175) | yqhH | 1556540..1558213 (-) | 1674 | WP_003230203.1 | SNF2-related protein | - |
| AAHT64_RS08180 (AAHT64_08180) | gcvT | 1558655..1559743 (+) | 1089 | WP_003230205.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=995849 AAHT64_RS08165 WP_003230187.1 1555369..1555542(-) (sinI) [Bacillus subtilis subsp. subtilis strain R38]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=995849 AAHT64_RS08165 WP_003230187.1 1555369..1555542(-) (sinI) [Bacillus subtilis subsp. subtilis strain R38]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |