Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAVB74_RS10495 Genome accession   NZ_CP154920
Coordinates   1953690..1953863 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain FUA2232     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1948690..1958863
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB74_RS10450 (AAVB74_10450) comGE 1949041..1949388 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAVB74_RS10455 (AAVB74_10455) comGF 1949414..1949797 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAVB74_RS10460 (AAVB74_10460) comGG 1949798..1950172 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAVB74_RS10465 (AAVB74_10465) spoIIT 1950243..1950422 (+) 180 WP_003230176.1 YqzE family protein -
  AAVB74_RS10470 (AAVB74_10470) yqzG 1950464..1950790 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAVB74_RS10475 (AAVB74_10475) tapA 1951062..1951823 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB74_RS10480 (AAVB74_10480) sipW 1951807..1952379 (+) 573 WP_072692741.1 signal peptidase I -
  AAVB74_RS10485 (AAVB74_10485) tasA 1952443..1953228 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAVB74_RS10490 (AAVB74_10490) sinR 1953321..1953656 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAVB74_RS10495 (AAVB74_10495) sinI 1953690..1953863 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAVB74_RS10500 (AAVB74_10500) yqhG 1954046..1954840 (-) 795 WP_003230200.1 YqhG family protein -
  AAVB74_RS10505 (AAVB74_10505) yqhH 1954861..1956534 (-) 1674 WP_003230203.1 SNF2-related protein -
  AAVB74_RS10510 (AAVB74_10510) gcvT 1956976..1958064 (+) 1089 WP_345806081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=995462 AAVB74_RS10495 WP_003230187.1 1953690..1953863(-) (sinI) [Bacillus subtilis strain FUA2232]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=995462 AAVB74_RS10495 WP_003230187.1 1953690..1953863(-) (sinI) [Bacillus subtilis strain FUA2232]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment