Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AAVB74_RS10455 Genome accession   NZ_CP154920
Coordinates   1949414..1949797 (+) Length   127 a.a.
NCBI ID   WP_345806077.1    Uniprot ID   -
Organism   Bacillus subtilis strain FUA2232     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1944414..1954797
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB74_RS10420 (AAVB74_10420) corA 1944868..1945821 (+) 954 WP_015483432.1 magnesium transporter CorA -
  AAVB74_RS10425 (AAVB74_10425) - 1945823..1946020 (+) 198 WP_129134319.1 hypothetical protein -
  AAVB74_RS10430 (AAVB74_10430) comGA 1946232..1947302 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AAVB74_RS10435 (AAVB74_10435) comGB 1947289..1948326 (+) 1038 WP_345806075.1 comG operon protein ComGB Machinery gene
  AAVB74_RS10440 (AAVB74_10440) comGC 1948340..1948636 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAVB74_RS10445 (AAVB74_10445) comGD 1948626..1949057 (+) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  AAVB74_RS10450 (AAVB74_10450) comGE 1949041..1949388 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAVB74_RS10455 (AAVB74_10455) comGF 1949414..1949797 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAVB74_RS10460 (AAVB74_10460) comGG 1949798..1950172 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAVB74_RS10465 (AAVB74_10465) spoIIT 1950243..1950422 (+) 180 WP_003230176.1 YqzE family protein -
  AAVB74_RS10470 (AAVB74_10470) yqzG 1950464..1950790 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAVB74_RS10475 (AAVB74_10475) tapA 1951062..1951823 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB74_RS10480 (AAVB74_10480) sipW 1951807..1952379 (+) 573 WP_072692741.1 signal peptidase I -
  AAVB74_RS10485 (AAVB74_10485) tasA 1952443..1953228 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAVB74_RS10490 (AAVB74_10490) sinR 1953321..1953656 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAVB74_RS10495 (AAVB74_10495) sinI 1953690..1953863 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14285.36 Da        Isoelectric Point: 5.8929

>NTDB_id=995459 AAVB74_RS10455 WP_345806077.1 1949414..1949797(+) (comGF) [Bacillus subtilis strain FUA2232]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=995459 AAVB74_RS10455 WP_345806077.1 1949414..1949797(+) (comGF) [Bacillus subtilis strain FUA2232]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment