Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAYR29_RS23135 Genome accession   NZ_CP154918
Coordinates   4353249..4353389 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain FUA2231     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 4348249..4358389
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR29_RS23110 (AAYR29_23110) yueI 4348542..4348940 (+) 399 WP_345805925.1 YueI family protein -
  AAYR29_RS23115 (AAYR29_23115) pncA 4349037..4349588 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AAYR29_RS23120 (AAYR29_23120) pncB 4349604..4351076 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AAYR29_RS23125 (AAYR29_23125) pdeH 4351213..4352442 (+) 1230 WP_345805927.1 cyclic di-GMP phosphodiesterase -
  AAYR29_RS23130 (AAYR29_23130) - 4352418..4352786 (-) 369 WP_017695529.1 hypothetical protein -
  AAYR29_RS23135 (AAYR29_23135) degQ 4353249..4353389 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAYR29_RS23140 (AAYR29_23140) - 4353574..4354437 (+) 864 WP_345805928.1 polyprenyl synthetase family protein -
  AAYR29_RS23145 (AAYR29_23145) comX 4354439..4354660 (+) 222 WP_014480704.1 competence pheromone ComX -
  AAYR29_RS23150 (AAYR29_23150) comP 4354676..4356988 (+) 2313 WP_213418792.1 histidine kinase Regulator
  AAYR29_RS23155 (AAYR29_23155) comA 4357069..4357713 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AAYR29_RS23160 (AAYR29_23160) yuxO 4357732..4358112 (+) 381 WP_014477831.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=995417 AAYR29_RS23135 WP_003220708.1 4353249..4353389(+) (degQ) [Bacillus subtilis strain FUA2231]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995417 AAYR29_RS23135 WP_003220708.1 4353249..4353389(+) (degQ) [Bacillus subtilis strain FUA2231]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment