Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AAYR29_RS03710 Genome accession   NZ_CP154918
Coordinates   639509..639883 (+) Length   124 a.a.
NCBI ID   WP_345806078.1    Uniprot ID   -
Organism   Bacillus subtilis strain FUA2231     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 634509..644883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR29_RS03670 (AAYR29_03670) corA 634579..635532 (+) 954 WP_015483432.1 magnesium transporter CorA -
  AAYR29_RS03675 (AAYR29_03675) - 635534..635731 (+) 198 WP_129134319.1 hypothetical protein -
  AAYR29_RS03680 (AAYR29_03680) comGA 635943..637013 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AAYR29_RS03685 (AAYR29_03685) comGB 637000..638037 (+) 1038 WP_345806075.1 comG operon protein ComGB Machinery gene
  AAYR29_RS03690 (AAYR29_03690) comGC 638051..638347 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAYR29_RS03695 (AAYR29_03695) comGD 638337..638768 (+) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  AAYR29_RS03700 (AAYR29_03700) comGE 638752..639099 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAYR29_RS03705 (AAYR29_03705) comGF 639125..639508 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAYR29_RS03710 (AAYR29_03710) comGG 639509..639883 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAYR29_RS03715 (AAYR29_03715) spoIIT 639954..640133 (+) 180 WP_003230176.1 YqzE family protein -
  AAYR29_RS03720 (AAYR29_03720) yqzG 640175..640501 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAYR29_RS03725 (AAYR29_03725) tapA 640773..641534 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAYR29_RS03730 (AAYR29_03730) sipW 641518..642090 (+) 573 WP_072692741.1 signal peptidase I -
  AAYR29_RS03735 (AAYR29_03735) tasA 642154..642939 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAYR29_RS03740 (AAYR29_03740) sinR 643032..643367 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAYR29_RS03745 (AAYR29_03745) sinI 643401..643574 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAYR29_RS03750 (AAYR29_03750) yqhG 643757..644551 (-) 795 WP_003230200.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14524.69 Da        Isoelectric Point: 9.2806

>NTDB_id=995360 AAYR29_RS03710 WP_345806078.1 639509..639883(+) (comGG) [Bacillus subtilis strain FUA2231]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVQEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=995360 AAYR29_RS03710 WP_345806078.1 639509..639883(+) (comGG) [Bacillus subtilis strain FUA2231]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCTATTCGGCATGTTCAAGAGGAACGGAAAGGCCAGGAGGGGACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
GGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGTTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968


Multiple sequence alignment