Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAVC46_RS10075 Genome accession   NZ_CP154913
Coordinates   1905806..1905946 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain FUA2119     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1900806..1910946
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC46_RS10050 (AAVC46_10050) - 1901072..1901461 (-) 390 WP_034659822.1 hotdog fold thioesterase -
  AAVC46_RS10055 (AAVC46_10055) comA 1901485..1902126 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  AAVC46_RS10060 (AAVC46_10060) comP 1902207..1904519 (-) 2313 WP_340973638.1 ATP-binding protein Regulator
  AAVC46_RS10065 (AAVC46_10065) comX 1904573..1904743 (-) 171 WP_080869541.1 competence pheromone ComX -
  AAVC46_RS10070 (AAVC46_10070) - 1904740..1905654 (-) 915 WP_340973639.1 polyprenyl synthetase family protein -
  AAVC46_RS10075 (AAVC46_10075) degQ 1905806..1905946 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAVC46_RS10080 (AAVC46_10080) - 1906452..1906805 (+) 354 WP_340973640.1 inner spore coat protein -
  AAVC46_RS10085 (AAVC46_10085) - 1906839..1908065 (-) 1227 WP_334750679.1 HDOD domain-containing protein -
  AAVC46_RS10090 (AAVC46_10090) - 1908203..1909672 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  AAVC46_RS10095 (AAVC46_10095) - 1909690..1910241 (-) 552 WP_127687105.1 isochorismatase family cysteine hydrolase -
  AAVC46_RS10100 (AAVC46_10100) - 1910302..1910709 (-) 408 WP_060597219.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=995320 AAVC46_RS10075 WP_003213123.1 1905806..1905946(-) (degQ) [Bacillus pumilus strain FUA2119]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995320 AAVC46_RS10075 WP_003213123.1 1905806..1905946(-) (degQ) [Bacillus pumilus strain FUA2119]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment