Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAVC94_RS14885 Genome accession   NZ_CP154906
Coordinates   2871420..2871560 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain FUA2115     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2866420..2876560
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC94_RS14860 (AAVC94_14860) - 2866761..2867150 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  AAVC94_RS14865 (AAVC94_14865) comA 2867174..2867815 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  AAVC94_RS14870 (AAVC94_14870) comP 2867896..2870181 (-) 2286 WP_253622277.1 ATP-binding protein Regulator
  AAVC94_RS14875 (AAVC94_14875) comX 2870188..2870367 (-) 180 WP_137054465.1 competence pheromone ComX -
  AAVC94_RS14880 (AAVC94_14880) - 2870345..2871268 (-) 924 WP_338423204.1 polyprenyl synthetase family protein -
  AAVC94_RS14885 (AAVC94_14885) degQ 2871420..2871560 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAVC94_RS14890 (AAVC94_14890) - 2872066..2872419 (+) 354 WP_212045491.1 inner spore coat protein -
  AAVC94_RS14895 (AAVC94_14895) - 2872450..2873676 (-) 1227 WP_212045764.1 HDOD domain-containing protein -
  AAVC94_RS14900 (AAVC94_14900) - 2873817..2875286 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  AAVC94_RS14905 (AAVC94_14905) - 2875304..2875855 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  AAVC94_RS14910 (AAVC94_14910) - 2875916..2876323 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=995084 AAVC94_RS14885 WP_003213123.1 2871420..2871560(-) (degQ) [Bacillus pumilus strain FUA2115]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995084 AAVC94_RS14885 WP_003213123.1 2871420..2871560(-) (degQ) [Bacillus pumilus strain FUA2115]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment