Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AAVC70_RS02680 Genome accession   NZ_CP154898
Coordinates   360146..360523 (-) Length   125 a.a.
NCBI ID   WP_013352867.1    Uniprot ID   A0A9P1JIN8
Organism   Bacillus amyloliquefaciens strain Fad 97     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 355146..365523
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC70_RS02640 (AAVC70_02640) - 355644..356438 (+) 795 WP_013352859.1 YqhG family protein -
  AAVC70_RS02645 (AAVC70_02645) sinI 356618..356791 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  AAVC70_RS02650 (AAVC70_02650) sinR 356825..357160 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVC70_RS02655 (AAVC70_02655) - 357208..357993 (-) 786 WP_013352862.1 TasA family protein -
  AAVC70_RS02660 (AAVC70_02660) - 358058..358642 (-) 585 WP_013352863.1 signal peptidase I -
  AAVC70_RS02665 (AAVC70_02665) tapA 358614..359285 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVC70_RS02670 (AAVC70_02670) - 359543..359872 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVC70_RS02675 (AAVC70_02675) - 359913..360092 (-) 180 WP_013352866.1 YqzE family protein -
  AAVC70_RS02680 (AAVC70_02680) comGG 360146..360523 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVC70_RS02685 (AAVC70_02685) comGF 360525..361025 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVC70_RS02690 (AAVC70_02690) comGE 360934..361248 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVC70_RS02695 (AAVC70_02695) comGD 361232..361669 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAVC70_RS02700 (AAVC70_02700) comGC 361659..361967 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  AAVC70_RS02705 (AAVC70_02705) comGB 361972..363009 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAVC70_RS02710 (AAVC70_02710) comGA 362996..364066 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  AAVC70_RS02715 (AAVC70_02715) - 364260..365210 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.18 Da        Isoelectric Point: 10.2027

>NTDB_id=994823 AAVC70_RS02680 WP_013352867.1 360146..360523(-) (comGG) [Bacillus amyloliquefaciens strain Fad 97]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMIQGQKTQSGTQRFPYGTVS
FYINGNDRRETVQVTIKAVTASGTRREAHLLFNHKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=994823 AAVC70_RS02680 WP_013352867.1 360146..360523(-) (comGG) [Bacillus amyloliquefaciens strain Fad 97]
ATGTACAAATCTGACGGGTTTATATATCCGGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGTGAGAACCTGCTTCAAAACGGCG
CACTGCTGTCAAGCCGTCATATGATACAGGGACAAAAGACTCAGTCGGGCACACAGCGTTTTCCGTACGGAACCGTCTCC
TTTTACATCAACGGGAACGATCGCCGGGAAACGGTTCAAGTTACAATAAAGGCGGTAACAGCATCAGGGACGAGACGGGA
GGCTCACCTTTTATTCAATCATAAGAAGAAACAGCTGATTCAATGGACAGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment