Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AAVC70_RS02645 Genome accession   NZ_CP154898
Coordinates   356618..356791 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Fad 97     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 351618..361791
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC70_RS02630 (AAVC70_02630) gcvT 352429..353529 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  AAVC70_RS02635 (AAVC70_02635) - 353953..355623 (+) 1671 WP_014470658.1 SNF2-related protein -
  AAVC70_RS02640 (AAVC70_02640) - 355644..356438 (+) 795 WP_013352859.1 YqhG family protein -
  AAVC70_RS02645 (AAVC70_02645) sinI 356618..356791 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  AAVC70_RS02650 (AAVC70_02650) sinR 356825..357160 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVC70_RS02655 (AAVC70_02655) - 357208..357993 (-) 786 WP_013352862.1 TasA family protein -
  AAVC70_RS02660 (AAVC70_02660) - 358058..358642 (-) 585 WP_013352863.1 signal peptidase I -
  AAVC70_RS02665 (AAVC70_02665) tapA 358614..359285 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVC70_RS02670 (AAVC70_02670) - 359543..359872 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVC70_RS02675 (AAVC70_02675) - 359913..360092 (-) 180 WP_013352866.1 YqzE family protein -
  AAVC70_RS02680 (AAVC70_02680) comGG 360146..360523 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVC70_RS02685 (AAVC70_02685) comGF 360525..361025 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVC70_RS02690 (AAVC70_02690) comGE 360934..361248 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVC70_RS02695 (AAVC70_02695) comGD 361232..361669 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=994821 AAVC70_RS02645 WP_013352860.1 356618..356791(+) (sinI) [Bacillus amyloliquefaciens strain Fad 97]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=994821 AAVC70_RS02645 WP_013352860.1 356618..356791(+) (sinI) [Bacillus amyloliquefaciens strain Fad 97]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment