Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAYT23_RS02335 | Genome accession | NZ_CP154877 |
| Coordinates | 452411..452560 (+) | Length | 49 a.a. |
| NCBI ID | WP_001836413.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 20234295 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 447411..457560
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAYT23_RS02305 (AAYT23_02290) | comA/nlmT | 448478..449125 (-) | 648 | WP_078064020.1 | ATP-binding cassette domain-containing protein | Regulator |
| AAYT23_RS02310 (AAYT23_02295) | comA/nlmT | 449141..450154 (-) | 1014 | WP_318528993.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| AAYT23_RS02315 (AAYT23_02300) | comA/nlmT | 450048..450635 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| AAYT23_RS02320 (AAYT23_02305) | blpI | 450917..451114 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| AAYT23_RS02325 (AAYT23_02310) | blpJ | 451581..451850 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| AAYT23_RS02330 (AAYT23_02315) | blpK | 451919..452167 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| AAYT23_RS02335 (AAYT23_02320) | cipB | 452411..452560 (+) | 150 | WP_001836413.1 | bacteriocin-like peptide BlpO | Regulator |
| AAYT23_RS02340 | - | 452596..452661 (+) | 66 | Protein_459 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| AAYT23_RS02345 (AAYT23_02325) | - | 452664..452783 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AAYT23_RS02350 (AAYT23_02330) | - | 453264..453622 (+) | 359 | Protein_461 | immunity protein | - |
| AAYT23_RS02355 (AAYT23_02335) | - | 454251..454634 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| AAYT23_RS02360 (AAYT23_02340) | - | 454686..455375 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAYT23_RS02365 (AAYT23_02345) | blpZ | 455417..455650 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| AAYT23_RS02370 (AAYT23_02350) | - | 455801..456412 (+) | 612 | WP_000394036.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAYT23_RS02375 (AAYT23_02355) | ccrZ | 456573..457367 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5131.89 Da Isoelectric Point: 4.0439
>NTDB_id=994437 AAYT23_RS02335 WP_001836413.1 452411..452560(+) (cipB) [Streptococcus pneumoniae strain 20234295]
MNTKMMSQFSVIDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVIDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=994437 AAYT23_RS02335 WP_001836413.1 452411..452560(+) (cipB) [Streptococcus pneumoniae strain 20234295]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATAGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATAGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |