Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAHT65_RS01670 Genome accession   NZ_CP154443
Coordinates   302079..302222 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SW     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 297079..307222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT65_RS01645 (AAHT65_01645) - 297401..297781 (-) 381 WP_010789785.1 hotdog fold thioesterase -
  AAHT65_RS01650 (AAHT65_01650) comA 297799..298440 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  AAHT65_RS01655 (AAHT65_01655) comP 298521..300827 (-) 2307 WP_343310884.1 two-component system sensor histidine kinase ComP Regulator
  AAHT65_RS01660 (AAHT65_01660) comX 300841..301008 (-) 168 WP_094232702.1 competence pheromone ComX Regulator
  AAHT65_RS01665 (AAHT65_01665) comQ 300992..301894 (-) 903 WP_094233215.1 polyprenyl synthetase family protein Regulator
  AAHT65_RS01670 (AAHT65_01670) degQ 302079..302222 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  AAHT65_RS01675 (AAHT65_01675) - 302682..303041 (+) 360 WP_343310885.1 hypothetical protein -
  AAHT65_RS01680 (AAHT65_01680) - 303060..304292 (-) 1233 WP_327853172.1 EAL and HDOD domain-containing protein -
  AAHT65_RS01685 (AAHT65_01685) - 304430..305896 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  AAHT65_RS01690 (AAHT65_01690) - 305912..306463 (-) 552 WP_063637896.1 cysteine hydrolase family protein -
  AAHT65_RS01695 (AAHT65_01695) - 306571..306969 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=993402 AAHT65_RS01670 WP_003327149.1 302079..302222(-) (degQ) [Bacillus atrophaeus strain SW]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=993402 AAHT65_RS01670 WP_003327149.1 302079..302222(-) (degQ) [Bacillus atrophaeus strain SW]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment