Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   AAHT65_RS01660 Genome accession   NZ_CP154443
Coordinates   300841..301008 (-) Length   55 a.a.
NCBI ID   WP_094232702.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SW     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 295841..306008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT65_RS01630 (AAHT65_01630) - 296244..296720 (+) 477 WP_094232698.1 Na+/H+ antiporter subunit E -
  AAHT65_RS01635 (AAHT65_01635) - 296720..297004 (+) 285 WP_094232699.1 Na(+)/H(+) antiporter subunit F1 -
  AAHT65_RS01640 (AAHT65_01640) mnhG 296988..297362 (+) 375 WP_061570550.1 monovalent cation/H(+) antiporter subunit G -
  AAHT65_RS01645 (AAHT65_01645) - 297401..297781 (-) 381 WP_010789785.1 hotdog fold thioesterase -
  AAHT65_RS01650 (AAHT65_01650) comA 297799..298440 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  AAHT65_RS01655 (AAHT65_01655) comP 298521..300827 (-) 2307 WP_343310884.1 two-component system sensor histidine kinase ComP Regulator
  AAHT65_RS01660 (AAHT65_01660) comX 300841..301008 (-) 168 WP_094232702.1 competence pheromone ComX Regulator
  AAHT65_RS01665 (AAHT65_01665) comQ 300992..301894 (-) 903 WP_094233215.1 polyprenyl synthetase family protein Regulator
  AAHT65_RS01670 (AAHT65_01670) degQ 302079..302222 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  AAHT65_RS01675 (AAHT65_01675) - 302682..303041 (+) 360 WP_343310885.1 hypothetical protein -
  AAHT65_RS01680 (AAHT65_01680) - 303060..304292 (-) 1233 WP_327853172.1 EAL and HDOD domain-containing protein -
  AAHT65_RS01685 (AAHT65_01685) - 304430..305896 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6586.47 Da        Isoelectric Point: 4.6094

>NTDB_id=993400 AAHT65_RS01660 WP_094232702.1 300841..301008(-) (comX) [Bacillus atrophaeus strain SW]
MQDLINYFLNYPEVLKKLKNKEACLIGFDLDETQTILKAYDDYHMSAQRTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=993400 AAHT65_RS01660 WP_094232702.1 300841..301008(-) (comX) [Bacillus atrophaeus strain SW]
ATGCAAGATCTAATTAATTACTTTTTAAATTATCCTGAAGTATTAAAAAAATTGAAAAATAAAGAAGCTTGCCTTATAGG
TTTTGATTTAGACGAAACTCAAACAATACTTAAAGCTTACGATGATTATCATATGTCTGCTCAAAGAACTCGTGAATGGG
ACGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

75.472

96.364

0.727

Multiple sequence alignment