Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAC934_RS16305 Genome accession   NZ_CP152362
Coordinates   3149104..3149244 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain LP     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3144104..3154244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAC934_RS16280 (AAC934_16280) yuxO 3144473..3144853 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  AAC934_RS16285 (AAC934_16285) comA 3144872..3145516 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AAC934_RS16290 (AAC934_16290) comP 3145597..3147816 (-) 2220 WP_342623517.1 histidine kinase Regulator
  AAC934_RS16295 (AAC934_16295) comX 3147832..3148053 (-) 222 WP_014114983.1 competence pheromone ComX -
  AAC934_RS16300 (AAC934_16300) - 3148050..3148919 (-) 870 WP_277736668.1 polyprenyl synthetase family protein -
  AAC934_RS16305 (AAC934_16305) degQ 3149104..3149244 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAC934_RS16310 (AAC934_16310) - 3149466..3149591 (+) 126 WP_003228793.1 hypothetical protein -
  AAC934_RS16315 (AAC934_16315) - 3149705..3150073 (+) 369 WP_014477834.1 hypothetical protein -
  AAC934_RS16320 (AAC934_16320) pdeH 3150049..3151278 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AAC934_RS16325 (AAC934_16325) pncB 3151416..3152888 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AAC934_RS16330 (AAC934_16330) pncA 3152904..3153455 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  AAC934_RS16335 (AAC934_16335) yueI 3153552..3153950 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=988638 AAC934_RS16305 WP_003220708.1 3149104..3149244(-) (degQ) [Bacillus subtilis strain LP]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=988638 AAC934_RS16305 WP_003220708.1 3149104..3149244(-) (degQ) [Bacillus subtilis strain LP]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment