Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NYE62_RS12920 Genome accession   NZ_CP152037
Coordinates   2643199..2643513 (-) Length   104 a.a.
NCBI ID   WP_144663989.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-2861     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2638199..2648513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE62_RS12875 (NYE62_12875) sinI 2638881..2639054 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  NYE62_RS12880 (NYE62_12880) sinR 2639088..2639423 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYE62_RS12885 (NYE62_12885) - 2639471..2640256 (-) 786 WP_007408329.1 TasA family protein -
  NYE62_RS12890 (NYE62_12890) - 2640321..2640905 (-) 585 WP_144663990.1 signal peptidase I -
  NYE62_RS12895 (NYE62_12895) tapA 2640877..2641548 (-) 672 WP_095352946.1 amyloid fiber anchoring/assembly protein TapA -
  NYE62_RS12900 (NYE62_12900) - 2641807..2642136 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NYE62_RS12905 (NYE62_12905) - 2642176..2642355 (-) 180 WP_003153093.1 YqzE family protein -
  NYE62_RS12910 (NYE62_12910) comGG 2642412..2642789 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYE62_RS12915 (NYE62_12915) comGF 2642790..2643290 (-) 501 WP_260854721.1 competence type IV pilus minor pilin ComGF -
  NYE62_RS12920 (NYE62_12920) comGE 2643199..2643513 (-) 315 WP_144663989.1 competence type IV pilus minor pilin ComGE Machinery gene
  NYE62_RS12925 (NYE62_12925) comGD 2643497..2643934 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  NYE62_RS12930 (NYE62_12930) comGC 2643924..2644232 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NYE62_RS12935 (NYE62_12935) comGB 2644237..2645274 (-) 1038 WP_342496985.1 competence type IV pilus assembly protein ComGB Machinery gene
  NYE62_RS12940 (NYE62_12940) comGA 2645261..2646331 (-) 1071 WP_342496986.1 competence type IV pilus ATPase ComGA Machinery gene
  NYE62_RS12945 (NYE62_12945) - 2646524..2647474 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11858.87 Da        Isoelectric Point: 6.9470

>NTDB_id=986216 NYE62_RS12920 WP_144663989.1 2643199..2643513(-) (comGE) [Bacillus sp. FSL K6-2861]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTAMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=986216 NYE62_RS12920 WP_144663989.1 2643199..2643513(-) (comGE) [Bacillus sp. FSL K6-2861]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGCCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment