Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE62_RS12875 | Genome accession | NZ_CP152037 |
| Coordinates | 2638881..2639054 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. FSL K6-2861 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2633881..2644054
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE62_RS12860 (NYE62_12860) | gcvT | 2634694..2635794 (-) | 1101 | WP_015240202.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE62_RS12865 (NYE62_12865) | - | 2636218..2637888 (+) | 1671 | WP_063094778.1 | SNF2-related protein | - |
| NYE62_RS12870 (NYE62_12870) | - | 2637910..2638704 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| NYE62_RS12875 (NYE62_12875) | sinI | 2638881..2639054 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| NYE62_RS12880 (NYE62_12880) | sinR | 2639088..2639423 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE62_RS12885 (NYE62_12885) | - | 2639471..2640256 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| NYE62_RS12890 (NYE62_12890) | - | 2640321..2640905 (-) | 585 | WP_144663990.1 | signal peptidase I | - |
| NYE62_RS12895 (NYE62_12895) | tapA | 2640877..2641548 (-) | 672 | WP_095352946.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE62_RS12900 (NYE62_12900) | - | 2641807..2642136 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE62_RS12905 (NYE62_12905) | - | 2642176..2642355 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE62_RS12910 (NYE62_12910) | comGG | 2642412..2642789 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE62_RS12915 (NYE62_12915) | comGF | 2642790..2643290 (-) | 501 | WP_260854721.1 | competence type IV pilus minor pilin ComGF | - |
| NYE62_RS12920 (NYE62_12920) | comGE | 2643199..2643513 (-) | 315 | WP_144663989.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| NYE62_RS12925 (NYE62_12925) | comGD | 2643497..2643934 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=986213 NYE62_RS12875 WP_003153105.1 2638881..2639054(+) (sinI) [Bacillus sp. FSL K6-2861]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=986213 NYE62_RS12875 WP_003153105.1 2638881..2639054(+) (sinI) [Bacillus sp. FSL K6-2861]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |