Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8623_RS02535 | Genome accession | NZ_AP026928 |
| Coordinates | 495274..495423 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700406 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 490274..500423
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8623_RS02510 (PC0401_04890) | comA/nlmT | 491334..493010 (-) | 1677 | WP_215729172.1 | peptide cleavage/export ABC transporter | Regulator |
| R8623_RS02515 (PC0401_04900) | comA/nlmT | 492904..493491 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8623_RS02520 (PC0401_04910) | blpI | 493780..493977 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| R8623_RS02525 (PC0401_04920) | blpJ | 494444..494713 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| R8623_RS02530 (PC0401_04930) | blpK | 494782..495030 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| R8623_RS02535 (PC0401_04940) | cipB | 495274..495423 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| R8623_RS10930 | - | 495459..495524 (+) | 66 | Protein_499 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| R8623_RS02540 | - | 495527..495646 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8623_RS02545 (PC0401_04960) | - | 496127..496485 (+) | 359 | Protein_501 | immunity protein | - |
| R8623_RS02550 (PC0401_04980) | - | 497114..497497 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| R8623_RS02555 (PC0401_04990) | - | 497549..498238 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8623_RS02560 (PC0401_05000) | blpZ | 498280..498513 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| R8623_RS02565 | - | 498664..499275 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8623_RS02570 (PC0401_05010) | ccrZ | 499436..500230 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=98572 R8623_RS02535 WP_001809846.1 495274..495423(+) (cipB) [Streptococcus pneumoniae strain PZ900700406]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=98572 R8623_RS02535 WP_001809846.1 495274..495423(+) (cipB) [Streptococcus pneumoniae strain PZ900700406]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |