Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8611_RS02460 | Genome accession | NZ_AP026927 |
| Coordinates | 485446..485595 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700178 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 480446..490595
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8611_RS02430 (PC0174_04770) | blpC | 480670..480825 (-) | 156 | WP_000358811.1 | quorum-sensing system pheromone BlpC | - |
| R8611_RS02435 (PC0174_04780) | - | 480882..482243 (-) | 1362 | WP_033705510.1 | bacteriocin secretion accessory protein | - |
| R8611_RS02440 (PC0174_04790) | comA/nlmT | 482254..483930 (-) | 1677 | WP_307774337.1 | peptide cleavage/export ABC transporter | Regulator |
| R8611_RS02445 (PC0174_04800) | comA/nlmT | 483824..484411 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8611_RS02450 (PC0174_04810) | blpM | 484729..484983 (+) | 255 | WP_033705509.1 | two-peptide bacteriocin subunit BlpM | - |
| R8611_RS02455 (PC0174_04820) | blpN | 484999..485202 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| R8611_RS02460 (PC0174_04830) | cipB | 485446..485595 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| R8611_RS10745 | - | 485631..485696 (+) | 66 | Protein_486 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| R8611_RS02465 | - | 485699..485818 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8611_RS02470 (PC0174_04850) | - | 486286..486657 (+) | 372 | WP_033705507.1 | hypothetical protein | - |
| R8611_RS02475 | - | 486818..487787 (+) | 970 | Protein_489 | thioredoxin domain-containing protein | - |
| R8611_RS02480 (PC0174_04880) | - | 488034..488267 (+) | 234 | WP_033705506.1 | bacteriocin class II family protein | - |
| R8611_RS02485 (PC0174_04890) | - | 488299..488988 (+) | 690 | WP_050199695.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8611_RS02490 (PC0174_04900) | blpZ | 489030..489278 (+) | 249 | WP_000276506.1 | immunity protein BlpZ | - |
| R8611_RS02495 | - | 489308..489919 (+) | 612 | WP_000394042.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=98494 R8611_RS02460 WP_001809846.1 485446..485595(+) (cipB) [Streptococcus pneumoniae strain PZ900700178]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=98494 R8611_RS02460 WP_001809846.1 485446..485595(+) (cipB) [Streptococcus pneumoniae strain PZ900700178]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |