Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NYE28_RS16545 Genome accession   NZ_CP152013
Coordinates   3283086..3283226 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. FSL R5-0443     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3278086..3288226
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE28_RS16520 (NYE28_16520) - 3278426..3278809 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  NYE28_RS16525 (NYE28_16525) comA 3278831..3279475 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NYE28_RS16530 (NYE28_16530) comP 3279556..3281847 (-) 2292 WP_160223246.1 histidine kinase Regulator
  NYE28_RS16535 (NYE28_16535) comX 3281859..3282023 (-) 165 WP_061581461.1 competence pheromone ComX -
  NYE28_RS16540 (NYE28_16540) - 3282023..3282901 (-) 879 WP_038460875.1 polyprenyl synthetase family protein -
  NYE28_RS16545 (NYE28_16545) degQ 3283086..3283226 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NYE28_RS16550 (NYE28_16550) - 3283691..3284032 (+) 342 WP_025285192.1 hypothetical protein -
  NYE28_RS16555 (NYE28_16555) - 3284039..3285262 (-) 1224 WP_342490171.1 EAL and HDOD domain-containing protein -
  NYE28_RS16560 (NYE28_16560) - 3285392..3286858 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  NYE28_RS16565 (NYE28_16565) - 3286876..3287427 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  NYE28_RS16570 (NYE28_16570) - 3287524..3287922 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=984923 NYE28_RS16545 WP_003152043.1 3283086..3283226(-) (degQ) [Bacillus sp. FSL R5-0443]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=984923 NYE28_RS16545 WP_003152043.1 3283086..3283226(-) (degQ) [Bacillus sp. FSL R5-0443]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment