Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8507_RS02470 | Genome accession | NZ_AP026925 |
| Coordinates | 475647..475796 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700097 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 470647..480796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8507_RS02445 (PC0094_04810) | comA/nlmT | 471792..473390 (-) | 1599 | WP_317643771.1 | peptide cleavage/export ABC transporter | Regulator |
| R8507_RS02450 (PC0094_04820) | comA/nlmT | 473284..473871 (-) | 588 | WP_317643599.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8507_RS02455 (PC0094_04830) | blpI | 474153..474350 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| R8507_RS02460 (PC0094_04840) | blpJ | 474817..475086 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| R8507_RS02465 (PC0094_04850) | blpK | 475155..475403 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| R8507_RS02470 (PC0094_04860) | cipB | 475647..475796 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| R8507_RS10830 | - | 475832..475897 (+) | 66 | Protein_487 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| R8507_RS02475 | - | 475900..476019 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8507_RS02480 (PC0094_04880) | - | 476539..476871 (+) | 333 | WP_224757293.1 | immunity protein | - |
| R8507_RS02485 (PC0094_04900) | - | 477500..477883 (+) | 384 | WP_016398494.1 | hypothetical protein | - |
| R8507_RS02490 (PC0094_04910) | - | 477935..478624 (+) | 690 | WP_000760523.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8507_RS02495 (PC0094_04920) | blpZ | 478666..478899 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| R8507_RS02500 | - | 479050..479661 (+) | 612 | WP_000394036.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8507_RS02505 (PC0094_04930) | ccrZ | 479822..480616 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=98334 R8507_RS02470 WP_001809846.1 475647..475796(+) (cipB) [Streptococcus pneumoniae strain PZ900700097]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=98334 R8507_RS02470 WP_001809846.1 475647..475796(+) (cipB) [Streptococcus pneumoniae strain PZ900700097]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |